(data stored in SCRATCH zone)

EMBL: CP002417.PE124

CP002417.PE124       Location/Qualifiers
FT   CDS             complement(128426..129172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0125"
FT                   /product="Protein of unknown function DUF2086"
FT                   /note="PFAM: Protein of unknown function DUF2086; KEGG:
FT                   vap:Vapar_0109 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34347"
FT                   /db_xref="GOA:E6UZ18"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR018655"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ18"
FT                   /inference="protein motif:PFAM:PF09859"
FT                   /protein_id="ADU34347.1"
FT                   /translation="MLAARRDTAGMTTTHPSRIDALDWPRIETDLATRGCATTGQLFTP
FT                   KECAQLAAMYDEGGHHFRSRVVMQRHGFGEGEYQYFANPLPPLITAWRSALYERLAPLA
FT                   NAWASAMGQAADYPPDHAAYLARCHAAGQLRPTPLLLRYDEGDYNCLHQDLYGDLQFPL
FT                   QLTVLLSRPGEDFTGGEFVLTEQRPRMQSRAEVVSLAQGEAVIFAVNQRPVAGTRGTYR
FT                   VTMRHGVSRLRSGRRHTVGLIFHDAR"
     MLAARRDTAG MTTTHPSRID ALDWPRIETD LATRGCATTG QLFTPKECAQ LAAMYDEGGH        60
     HFRSRVVMQR HGFGEGEYQY FANPLPPLIT AWRSALYERL APLANAWASA MGQAADYPPD       120
     HAAYLARCHA AGQLRPTPLL LRYDEGDYNC LHQDLYGDLQ FPLQLTVLLS RPGEDFTGGE       180
     FVLTEQRPRM QSRAEVVSLA QGEAVIFAVN QRPVAGTRGT YRVTMRHGVS RLRSGRRHTV       240
     GLIFHDAR                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page