(data stored in SCRATCH zone)

EMBL: CP002417.PE126

CP002417.PE126       Location/Qualifiers
FT   CDS             131194..131700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0127"
FT                   /product="glutathione-dependent formaldehyde-activating
FT                   GFA"
FT                   /note="PFAM: glutathione-dependent formaldehyde-activating
FT                   GFA; KEGG: sme:SMc04177 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34349"
FT                   /db_xref="GOA:E6UZ20"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ20"
FT                   /inference="protein motif:PFAM:PF04828"
FT                   /protein_id="ADU34349.1"
FT                   /translation="MSTSKRPPADQGTNDWQLPWDGGCRCGQVRFRITAPPLLSMACHC
FT                   AGCQRMSASAFSLSLAIPTPGFEVVAGEPVIGGLHGDSHHFCCPHCKSWMFTRTEGMDE
FT                   FVNIRPTMLDRHEWFVPFMETWTDEKLPWVTTPAVHSFGKLPDFAAFPALIQAYAQEGA
FT                   RPGKA"
     MSTSKRPPAD QGTNDWQLPW DGGCRCGQVR FRITAPPLLS MACHCAGCQR MSASAFSLSL        60
     AIPTPGFEVV AGEPVIGGLH GDSHHFCCPH CKSWMFTRTE GMDEFVNIRP TMLDRHEWFV       120
     PFMETWTDEK LPWVTTPAVH SFGKLPDFAA FPALIQAYAQ EGARPGKA                    168
//

If you have problems or comments...

PBIL Back to PBIL home page