(data stored in ACNUC1104 zone)

EMBL: CP002417.PE127

CP002417.PE127       Location/Qualifiers
FT   CDS             complement(131711..132652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0128"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: pfl:PFL_1558 AraC family transcriptional
FT                   regulator; PFAM: transcription activator effector binding;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34350"
FT                   /db_xref="GOA:E6UZ21"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ21"
FT                   /inference="protein motif:PFAM:PF06445"
FT                   /protein_id="ADU34350.1"
FT                   /translation="MRAMTTRDSRSEYEWRMHKVLTHIDDHLDEPLELAALADVAHFSA
FT                   SHFHRLFAAWAGETLGDYIRRRRVEVAALRLATQPHLSVLEAAVSVGFGSGEAFTRAFR
FT                   AHFGSAPSAWRAAHDGSPPCDDPSRDSNPDQIALHGFTKNGSPLRNPAHEEPPVNVQLI
FT                   TRPPVTIAYLRYTGPFGAPVGAFWATKVAPWICAHDLWSHARYGISHDDPSITAPEHSR
FT                   YDACVEVPDNFVTDGGFHKTVLPGGRYVSLRFQGLPAEINDAWMRLMRDWLPASGFQFD
FT                   SRPAFEYYGPGMAFDEKTGAFECDICIPIAPL"
     MRAMTTRDSR SEYEWRMHKV LTHIDDHLDE PLELAALADV AHFSASHFHR LFAAWAGETL        60
     GDYIRRRRVE VAALRLATQP HLSVLEAAVS VGFGSGEAFT RAFRAHFGSA PSAWRAAHDG       120
     SPPCDDPSRD SNPDQIALHG FTKNGSPLRN PAHEEPPVNV QLITRPPVTI AYLRYTGPFG       180
     APVGAFWATK VAPWICAHDL WSHARYGISH DDPSITAPEH SRYDACVEVP DNFVTDGGFH       240
     KTVLPGGRYV SLRFQGLPAE INDAWMRLMR DWLPASGFQF DSRPAFEYYG PGMAFDEKTG       300
     AFECDICIPI APL                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page