(data stored in ACNUC1104 zone)

EMBL: CP002417.PE128

CP002417.PE128       Location/Qualifiers
FT   CDS             complement(132655..133557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0129"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: vap:Vapar_0117 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34351"
FT                   /db_xref="GOA:E6UZ22"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ22"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU34351.1"
FT                   /translation="MRRKIPPLQTLVCFDAAARHESYTRAAQELALTQSAVSRQIGTLE
FT                   AFLGVALFRRTRHGVALTASGAAYARQITKRLEAMERDTLDAMAHQGEGGSLSLAAVPT
FT                   FATRWLMPRLKGFAALQPDVVVHIETRTRPFLFADAEFDAALYAGTPAQVENWAGTRAL
FT                   LLMHEDVVPVCSPSLLPRGKAVAPAVISKMPLLQQSTRPDGWRQWFDAQQIDAPNARGG
FT                   PRYELFSILAAAASHGLGVALMPTMLVADELARGELVVACARPLSGERNYYLVTPERAD
FT                   QRPLLKFFSDWLLEQARQG"
     MRRKIPPLQT LVCFDAAARH ESYTRAAQEL ALTQSAVSRQ IGTLEAFLGV ALFRRTRHGV        60
     ALTASGAAYA RQITKRLEAM ERDTLDAMAH QGEGGSLSLA AVPTFATRWL MPRLKGFAAL       120
     QPDVVVHIET RTRPFLFADA EFDAALYAGT PAQVENWAGT RALLLMHEDV VPVCSPSLLP       180
     RGKAVAPAVI SKMPLLQQST RPDGWRQWFD AQQIDAPNAR GGPRYELFSI LAAAASHGLG       240
     VALMPTMLVA DELARGELVV ACARPLSGER NYYLVTPERA DQRPLLKFFS DWLLEQARQG       300
//

If you have problems or comments...

PBIL Back to PBIL home page