(data stored in ACNUC1104 zone)

EMBL: CP002417.PE130

CP002417.PE130       Location/Qualifiers
FT   CDS             134953..136188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0131"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: vap:Vapar_0119 L-carnitine
FT                   dehydratase/bile acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34353"
FT                   /db_xref="GOA:E6UZ24"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ24"
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /protein_id="ADU34353.1"
FT                   /translation="MTKPAALDGIKVLDLSRVLAGPWCTQILADLGADVIKIERPGVGD
FT                   DTRTWGPPFIKDADGNDTDQASYFTACNRNKRSVTVDMATAEGQALLQQMAAQADIVVE
FT                   NFKTGGLKQYGLDQESLRAANPRLIYCSVTGFGHDGPYAERAGYDLMIQAMTGMMSITG
FT                   RPDDVPGGGPLRVGVALTDLFTGVYASTAILAALQVRDRTGEGQHIDMALLDVGMAILA
FT                   NQASAFLNTGKAPQRQGNTHPSLAPYQDFPTLDGSMLLAIGNNGQFARFCEAAAHAEWA
FT                   ADARFATNTLRVKHRGVLIPMMEELTRTRTTADWVTLLEDKAVPCGPINDIAQAFDDAQ
FT                   VKARGLAVTLPRDAGDGIASITGVASPLRLSATPPVLRHAPPALGQHTREVLAEFGIDA
FT                   ARFDALRSAGVV"
     MTKPAALDGI KVLDLSRVLA GPWCTQILAD LGADVIKIER PGVGDDTRTW GPPFIKDADG        60
     NDTDQASYFT ACNRNKRSVT VDMATAEGQA LLQQMAAQAD IVVENFKTGG LKQYGLDQES       120
     LRAANPRLIY CSVTGFGHDG PYAERAGYDL MIQAMTGMMS ITGRPDDVPG GGPLRVGVAL       180
     TDLFTGVYAS TAILAALQVR DRTGEGQHID MALLDVGMAI LANQASAFLN TGKAPQRQGN       240
     THPSLAPYQD FPTLDGSMLL AIGNNGQFAR FCEAAAHAEW AADARFATNT LRVKHRGVLI       300
     PMMEELTRTR TTADWVTLLE DKAVPCGPIN DIAQAFDDAQ VKARGLAVTL PRDAGDGIAS       360
     ITGVASPLRL SATPPVLRHA PPALGQHTRE VLAEFGIDAA RFDALRSAGV V                411
//

If you have problems or comments...

PBIL Back to PBIL home page