(data stored in ACNUC1104 zone)

EMBL: CP002417.PE131

CP002417.PE131       Location/Qualifiers
FT   CDS             136205..136636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0132"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: vap:Vapar_0120
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34354"
FT                   /db_xref="GOA:E6UZ25"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ25"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADU34354.1"
FT                   /translation="MTDSMRTPPFSVLRIDHVVLRVKDADRAIAFYCDVLGCTVEKRRD
FT                   DLGLVHLRAGTNLIDLVTPEGPLGKQGGALAGKEGRNVDHLCLRIEPFDEAAIRALMAQ
FT                   HGVPVHGEVQNNFGAEGNGPSIYISDPDGNSVELKGAAG"
     MTDSMRTPPF SVLRIDHVVL RVKDADRAIA FYCDVLGCTV EKRRDDLGLV HLRAGTNLID        60
     LVTPEGPLGK QGGALAGKEG RNVDHLCLRI EPFDEAAIRA LMAQHGVPVH GEVQNNFGAE       120
     GNGPSIYISD PDGNSVELKG AAG                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page