(data stored in ACNUC1104 zone)

EMBL: CP002417.PE133

CP002417.PE133       Location/Qualifiers
FT   CDS             137352..137948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0134"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_6358 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34356"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ27"
FT                   /inference="similar to AA sequence:KEGG:Vapar_6358"
FT                   /protein_id="ADU34356.1"
FT                   /translation="MTSHPFAARIAARLSFAVGTAALLAACGTRQPAPPEPPPPEATAR
FT                   NSVVMSAVTYGATAKGIQLKKEDDACDVPASLKQAVQDQLLEPYEYLLAPPPTANAEGA
FT                   PVLKVEITDLLANAGGLYGGPKIVQLRGTLERKGEAPARFTAERQMFIYFGMPRSTCSM
FT                   VGVVTYALGEDIAKWLQKPVDGALLGELSTTAGKR"
     MTSHPFAARI AARLSFAVGT AALLAACGTR QPAPPEPPPP EATARNSVVM SAVTYGATAK        60
     GIQLKKEDDA CDVPASLKQA VQDQLLEPYE YLLAPPPTAN AEGAPVLKVE ITDLLANAGG       120
     LYGGPKIVQL RGTLERKGEA PARFTAERQM FIYFGMPRST CSMVGVVTYA LGEDIAKWLQ       180
     KPVDGALLGE LSTTAGKR                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page