(data stored in SCRATCH zone)

EMBL: CP002417.PE134

CP002417.PE134       Location/Qualifiers
FT   CDS             complement(137955..138413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0135"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0121 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34357"
FT                   /db_xref="GOA:E6UZ28"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ28"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0121"
FT                   /protein_id="ADU34357.1"
FT                   /translation="MPYAILLFLHLVAAAFWVGGMATMHFAVRPAAVATLEPPLRLRTM
FT                   AAALRRFFVGVDASVTLLFVSGVSMILLAGGFRSVHWRIEAMMSIAIVMAGIYVYIRAS
FT                   VFKALRRAVEESAWPVAAARLNTVRKLVSLNLALGVAVFAVATIGRAG"
     MPYAILLFLH LVAAAFWVGG MATMHFAVRP AAVATLEPPL RLRTMAAALR RFFVGVDASV        60
     TLLFVSGVSM ILLAGGFRSV HWRIEAMMSI AIVMAGIYVY IRASVFKALR RAVEESAWPV       120
     AAARLNTVRK LVSLNLALGV AVFAVATIGR AG                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page