(data stored in SCRATCH zone)

EMBL: CP002417.PE137

CP002417.PE137       Location/Qualifiers
FT   CDS             complement(139936..141627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0138"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0132 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34360"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ31"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0132"
FT                   /protein_id="ADU34360.1"
FT                   /translation="MPQLKTPAPLSIELTSPQSVNGKRAAFQSLWLLVRMQHAHDAEGG
FT                   LVRLADLRGEVSDASTLRMVVSRAFRDFKTWNIEVGWGEDTQREPRFLNAERRSQGPFW
FT                   LPAAEAKRMRVLVEGRAATAAEVASFLGLRSRKRHAAEPGSPPPDAVHLQDAAFWKQLV
FT                   ASQQAARQGRLMTPVAPMADSSATGLPVSALESIRLAGTLAATDFQRALVTLNEAMLWR
FT                   RLGDNEQARRRLQALKKQRLAHHVAGNDYLGAMECIVSAWCAYTARDLPLAQSLLSGMA
FT                   EDAARGLVLRHHPDVRFEWCNLWALVCRSRALGLSADDKPAAAALAEESLQRFGEALAA
FT                   AFESHSFDAAQHVAANMGMAAWLFDRVGLSDLPALAHDGHADTTRRAVQWIAFSEWLCG
FT                   HTDGQGRSAWNAIYLMRIARGHCRPDKQPTLAQFRMQKPLDPAAISRLAGPLADAFDAA
FT                   HWPARWVDVAQARLADHQAGRRRYPGLQHCSLLFEHAWYAAHAGDLKAAEQSLGVLREA
FT                   LPQLVPSDRAYFTESWNDTLPAELVLESKPPRRPAARKKAVGRTAR"
     MPQLKTPAPL SIELTSPQSV NGKRAAFQSL WLLVRMQHAH DAEGGLVRLA DLRGEVSDAS        60
     TLRMVVSRAF RDFKTWNIEV GWGEDTQREP RFLNAERRSQ GPFWLPAAEA KRMRVLVEGR       120
     AATAAEVASF LGLRSRKRHA AEPGSPPPDA VHLQDAAFWK QLVASQQAAR QGRLMTPVAP       180
     MADSSATGLP VSALESIRLA GTLAATDFQR ALVTLNEAML WRRLGDNEQA RRRLQALKKQ       240
     RLAHHVAGND YLGAMECIVS AWCAYTARDL PLAQSLLSGM AEDAARGLVL RHHPDVRFEW       300
     CNLWALVCRS RALGLSADDK PAAAALAEES LQRFGEALAA AFESHSFDAA QHVAANMGMA       360
     AWLFDRVGLS DLPALAHDGH ADTTRRAVQW IAFSEWLCGH TDGQGRSAWN AIYLMRIARG       420
     HCRPDKQPTL AQFRMQKPLD PAAISRLAGP LADAFDAAHW PARWVDVAQA RLADHQAGRR       480
     RYPGLQHCSL LFEHAWYAAH AGDLKAAEQS LGVLREALPQ LVPSDRAYFT ESWNDTLPAE       540
     LVLESKPPRR PAARKKAVGR TAR                                               563
//

If you have problems or comments...

PBIL Back to PBIL home page