(data stored in ACNUC1104 zone)

EMBL: CP002417.PE138

CP002417.PE138       Location/Qualifiers
FT   CDS             complement(141695..141889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0133 protein of unknown function
FT                   DUF1127"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34361"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ32"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0133"
FT                   /protein_id="ADU34361.1"
FT                   /translation="MTAPKPSTFHQRLMHALHDWRRRAAQRRRSRADSRHLTGMSDHEL
FT                   RDLGIGRSEVRELIDRNRY"
     MTAPKPSTFH QRLMHALHDW RRRAAQRRRS RADSRHLTGM SDHELRDLGI GRSEVRELID        60
     RNRY                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page