(data stored in ACNUC1104 zone)

EMBL: CP002417.PE14

CP002417.PE14        Location/Qualifiers
FT   CDS             14461..14895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0014"
FT                   /product="serine/threonine kinase"
FT                   /note="KEGG: vap:Vapar_0014 serine/threonine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34237"
FT                   /db_xref="GOA:E6UXP3"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXP3"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0014"
FT                   /protein_id="ADU34237.1"
FT                   /translation="MKQQTTIFKGTVLAVLMAAAGGAMAQATSIPAQPDPSVGGQASTM
FT                   TPAGVANPPQRPDNSMPASREAVKAEARVQNRNNANSMVPKGEATTTVNHQPNAMPRPT
FT                   GEQSRAEVSQQARKVKPQFGEKGERPEVPTNPTEKTGTPK"
     MKQQTTIFKG TVLAVLMAAA GGAMAQATSI PAQPDPSVGG QASTMTPAGV ANPPQRPDNS        60
     MPASREAVKA EARVQNRNNA NSMVPKGEAT TTVNHQPNAM PRPTGEQSRA EVSQQARKVK       120
     PQFGEKGERP EVPTNPTEKT GTPK                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page