(data stored in SCRATCH zone)

EMBL: CP002417.PE140

CP002417.PE140       Location/Qualifiers
FT   CDS             complement(142861..143898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0141"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: vap:Vapar_0135 acylamide
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34363"
FT                   /db_xref="GOA:E6UZ34"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR023719"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ34"
FT                   /inference="protein motif:PFAM:PF00795"
FT                   /protein_id="ADU34363.1"
FT                   /translation="MRHGDISSSSDCVGVAVVNYKMPRLHTKAEVLDNARKIGEMLVGM
FT                   KRGLPGMDLVIFPEYSTHGIMYDTKEMYDTAATVPGEETAIFADACRRANVWGVFSLTG
FT                   ERHEQHPDKAPYNTLILMNNEGEIVQKYRKIMPWVPIEGWYPGDRTYVSDGPKGMKISL
FT                   IVCDDGNYPEIWRDCTMRGAELVIRCQGYMYPAKEQQILVSKAMAFMNNTYVAVANAAG
FT                   FDGVYSYFGHSALIGFDGRTLGECGEEEMGINYAELSMSLIRDARRNGQSQNHLFKLMH
FT                   RGYTGLINSGDGDKGVADCPFDFYKQWINDPKGAREQVESFTRRTIGTAECPIEGLPNE
FT                   GSNQS"
     MRHGDISSSS DCVGVAVVNY KMPRLHTKAE VLDNARKIGE MLVGMKRGLP GMDLVIFPEY        60
     STHGIMYDTK EMYDTAATVP GEETAIFADA CRRANVWGVF SLTGERHEQH PDKAPYNTLI       120
     LMNNEGEIVQ KYRKIMPWVP IEGWYPGDRT YVSDGPKGMK ISLIVCDDGN YPEIWRDCTM       180
     RGAELVIRCQ GYMYPAKEQQ ILVSKAMAFM NNTYVAVANA AGFDGVYSYF GHSALIGFDG       240
     RTLGECGEEE MGINYAELSM SLIRDARRNG QSQNHLFKLM HRGYTGLINS GDGDKGVADC       300
     PFDFYKQWIN DPKGAREQVE SFTRRTIGTA ECPIEGLPNE GSNQS                       345
//

If you have problems or comments...

PBIL Back to PBIL home page