(data stored in ACNUC1104 zone)

EMBL: CP002417.PE141

CP002417.PE141       Location/Qualifiers
FT   CDS             complement(144093..144593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0142"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0136 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34364"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ35"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0136"
FT                   /protein_id="ADU34364.1"
FT                   /translation="MTEPIDSANPDTPALQQDRFWQDRGWTARIIKNEEDDGWAVEMTR
FT                   DGDPEPALVGPWTMGRDKKNPKPMDGPAFSTLVKTAAEVIRRHEQQLHATLNKSVTVTA
FT                   RDGRRIRVALAIVPDEDNPSATLSAHDDEDDSELASVNVSPAFKLTSGSATSWIEADFA
FT                   RPR"
     MTEPIDSANP DTPALQQDRF WQDRGWTARI IKNEEDDGWA VEMTRDGDPE PALVGPWTMG        60
     RDKKNPKPMD GPAFSTLVKT AAEVIRRHEQ QLHATLNKSV TVTARDGRRI RVALAIVPDE       120
     DNPSATLSAH DDEDDSELAS VNVSPAFKLT SGSATSWIEA DFARPR                      166
//

If you have problems or comments...

PBIL Back to PBIL home page