(data stored in ACNUC1104 zone)

EMBL: CP002417.PE144

CP002417.PE144       Location/Qualifiers
FT   CDS             complement(146744..147676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0145"
FT                   /product="Glutaminase, core"
FT                   /EC_number="3.5.1.2"
FT                   /note="TIGRFAM: Glutaminase, core; KEGG: vap:Vapar_0137
FT                   glutaminase; PFAM: Glutaminase, core"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34367"
FT                   /db_xref="GOA:E6UZ38"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ38"
FT                   /inference="protein motif:TFAM:TIGR03814"
FT                   /protein_id="ADU34367.1"
FT                   /translation="MMSFQHVLDDIVATLRPELGQAGTVASYIPALARVDARQFGIALR
FT                   TCEGEEAFAGDGEVPFSIQSVSKLFTLTLAMQRMGDALWERIGREPSGNPFNSLVQLEN
FT                   EQGKPRNPFINAGAIAVADRLVSQAAANGGSAKADILALMGGLCGEPIAFDEEVARSEA
FT                   DTGFRNVALANFMKSFGKIDNDVGTVLDTYFHQCSLRMSCRQLARAAAFLCRDGAHPID
FT                   GEPEITGERQTRRINALMLTCGTYDAAGDVAFSIGLPCKSGVGGGIVAVVPDKLTLCVW
FT                   SPALDATGNSLLGMKALELFVTRTGLSVF"
     MMSFQHVLDD IVATLRPELG QAGTVASYIP ALARVDARQF GIALRTCEGE EAFAGDGEVP        60
     FSIQSVSKLF TLTLAMQRMG DALWERIGRE PSGNPFNSLV QLENEQGKPR NPFINAGAIA       120
     VADRLVSQAA ANGGSAKADI LALMGGLCGE PIAFDEEVAR SEADTGFRNV ALANFMKSFG       180
     KIDNDVGTVL DTYFHQCSLR MSCRQLARAA AFLCRDGAHP IDGEPEITGE RQTRRINALM       240
     LTCGTYDAAG DVAFSIGLPC KSGVGGGIVA VVPDKLTLCV WSPALDATGN SLLGMKALEL       300
     FVTRTGLSVF                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page