(data stored in ACNUC1104 zone)

EMBL: CP002417.PE146

CP002417.PE146       Location/Qualifiers
FT   CDS             148841..149938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0147"
FT                   /product="Rieske (2Fe-2S) iron-sulfur domain"
FT                   /note="KEGG: bge:BC1002_5269 Rieske (2Fe-2S) iron-sulfur
FT                   domain protein; manually curated; PFAM: Rieske [2Fe-2S]
FT                   iron-sulphur domain"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34369"
FT                   /db_xref="GOA:E6UZ40"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ40"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ADU34369.1"
FT                   /translation="MISPLSPATQLPVSAYFDEALLRREQDEIFNKWPRYAGHSLLVPA
FT                   LNDYCVLPHHHNGLAMVHGEQGIQLFSNVCRHRQATILQGRGNSKRLSCPMHRWTYDNS
FT                   GVLIAAPKFTELPCMQLERFQTTAWKGLHFIGKTDAINELVNLPRDVKGLLDFESSYFG
FT                   HMEVHECNFNWKTFLEFYLEDYHVASFHPGLGHFVSCDNLRWFFGANWSAQMVSFHKRL
FT                   EQPGNSEIYRAWHQAVRTYYADDLPSIGAMWLLIYPNVMIEWYPLVTVISTVFPKGTGR
FT                   CVNVVEYYHPLDLKMRPDGDAMASLAASAYLETAVEDNQIGERIHEGRFALMSRRTSEY
FT                   GPYHENLEAGMVHFHQFLRDQLNCI"
     MISPLSPATQ LPVSAYFDEA LLRREQDEIF NKWPRYAGHS LLVPALNDYC VLPHHHNGLA        60
     MVHGEQGIQL FSNVCRHRQA TILQGRGNSK RLSCPMHRWT YDNSGVLIAA PKFTELPCMQ       120
     LERFQTTAWK GLHFIGKTDA INELVNLPRD VKGLLDFESS YFGHMEVHEC NFNWKTFLEF       180
     YLEDYHVASF HPGLGHFVSC DNLRWFFGAN WSAQMVSFHK RLEQPGNSEI YRAWHQAVRT       240
     YYADDLPSIG AMWLLIYPNV MIEWYPLVTV ISTVFPKGTG RCVNVVEYYH PLDLKMRPDG       300
     DAMASLAASA YLETAVEDNQ IGERIHEGRF ALMSRRTSEY GPYHENLEAG MVHFHQFLRD       360
     QLNCI                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page