(data stored in ACNUC1104 zone)

EMBL: CP002417.PE148

CP002417.PE148       Location/Qualifiers
FT   CDS             150418..151098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0149"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: hha:Hhal_1869 putative transcriptional
FT                   regulator; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34371"
FT                   /db_xref="GOA:E6UZ42"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR032350"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ42"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADU34371.1"
FT                   /translation="MELNTETRLHGLLIRRARELGKTLKMMAIEAGLARSGLYKLADGT
FT                   IRDPSVHTLLRLAAAMEVSPIALIRLYGDINAPAGVRDRGGSSLGRAQGLNDSRDAAML
FT                   NADVTIPHHAVVNGGEVFEKVWEVQNVGEVFWMGRRLVRVDRSCSRIDADLSAESRLHL
FT                   ASAAREIVIPNTPPGGVVRLSARFSAPRENCSIASVWRIEDQALRPCYGTGFFLGVIVT
FT                   VIDR"
     MELNTETRLH GLLIRRAREL GKTLKMMAIE AGLARSGLYK LADGTIRDPS VHTLLRLAAA        60
     MEVSPIALIR LYGDINAPAG VRDRGGSSLG RAQGLNDSRD AAMLNADVTI PHHAVVNGGE       120
     VFEKVWEVQN VGEVFWMGRR LVRVDRSCSR IDADLSAESR LHLASAAREI VIPNTPPGGV       180
     VRLSARFSAP RENCSIASVW RIEDQALRPC YGTGFFLGVI VTVIDR                      226
//

If you have problems or comments...

PBIL Back to PBIL home page