(data stored in ACNUC1104 zone)

EMBL: CP002417.PE150

CP002417.PE150       Location/Qualifiers
FT   CDS             complement(151648..152157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0151"
FT                   /product="flavin reductase domain protein FMN-binding
FT                   protein"
FT                   /note="KEGG: vap:Vapar_0140 flavin reductase domain protein
FT                   FMN-binding; manually curated; PFAM: flavin reductase
FT                   domain protein FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34373"
FT                   /db_xref="GOA:E6V059"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:E6V059"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ADU34373.1"
FT                   /translation="MTTPRRAQPPTFSPDEFREALGMFATGVTIVTACAADGTLVGLTA
FT                   NSFNSVSLTPPLVLWSLARAAGSMPALSTGSHYAVNILAASQKQLAERFATKNIDRWAD
FT                   VEFTRGIGGAPVLVGAAASFECFNRSRYDEGDHVIFVGEVERCTHDAGASPLLFHGGRF
FT                   YTEHPL"
     MTTPRRAQPP TFSPDEFREA LGMFATGVTI VTACAADGTL VGLTANSFNS VSLTPPLVLW        60
     SLARAAGSMP ALSTGSHYAV NILAASQKQL AERFATKNID RWADVEFTRG IGGAPVLVGA       120
     AASFECFNRS RYDEGDHVIF VGEVERCTHD AGASPLLFHG GRFYTEHPL                   169
//

If you have problems or comments...

PBIL Back to PBIL home page