(data stored in ACNUC1104 zone)

EMBL: CP002417.PE153

CP002417.PE153       Location/Qualifiers
FT   CDS             complement(155235..156464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0154"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   vap:Vapar_0141 nucleoside recognition domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34376"
FT                   /db_xref="GOA:E6V062"
FT                   /db_xref="InterPro:IPR011415"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:E6V062"
FT                   /inference="protein motif:PFAM:PF07670"
FT                   /protein_id="ADU34376.1"
FT                   /translation="MLNGLWLGFFGMAALAALVRWLVGGDPTVFAALVESLFTMARLAV
FT                   EVMVLLFGTLTLWLGFLRIAEAAGLVGWLARLLGPLFRRLMPGVPAGHPALGLITMNFA
FT                   ANALGLDNAATPIGLKAMRELQRLNPDPVTATNAQILFLVLNASSLTLLPVTIFMYRAQ
FT                   QGAPDPTMVFLPILLATSASTLVGLLTVAIAQRLRLWDPVVLAYLIPGALLLGGFMALL
FT                   GTLSAAAIASLSSLMGNLALFGVILVFLAAGAIRRIKVYECFIEGAKEGFDIAKNLLPY
FT                   LVAMLCAVGVLRASGALDFILGGLRWLVTAGGWDSRFVDAMPTALVKPFSGSAARAMLI
FT                   ETMKSQGVDSFPALVAATIQGSTETTFYVLAVYFGAVGIQRARHAVSCALLAELAGVVA
FT                   AIAVCYWFFG"
     MLNGLWLGFF GMAALAALVR WLVGGDPTVF AALVESLFTM ARLAVEVMVL LFGTLTLWLG        60
     FLRIAEAAGL VGWLARLLGP LFRRLMPGVP AGHPALGLIT MNFAANALGL DNAATPIGLK       120
     AMRELQRLNP DPVTATNAQI LFLVLNASSL TLLPVTIFMY RAQQGAPDPT MVFLPILLAT       180
     SASTLVGLLT VAIAQRLRLW DPVVLAYLIP GALLLGGFMA LLGTLSAAAI ASLSSLMGNL       240
     ALFGVILVFL AAGAIRRIKV YECFIEGAKE GFDIAKNLLP YLVAMLCAVG VLRASGALDF       300
     ILGGLRWLVT AGGWDSRFVD AMPTALVKPF SGSAARAMLI ETMKSQGVDS FPALVAATIQ       360
     GSTETTFYVL AVYFGAVGIQ RARHAVSCAL LAELAGVVAA IAVCYWFFG                   409
//

If you have problems or comments...

PBIL Back to PBIL home page