(data stored in SCRATCH zone)

EMBL: CP002417.PE154

CP002417.PE154       Location/Qualifiers
FT   CDS             156535..158112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0155"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="KEGG: vap:Vapar_0142 phospholipase
FT                   D/transphosphatidylase; PFAM: phospholipase
FT                   D/Transphosphatidylase; SMART: phospholipase
FT                   D/Transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34377"
FT                   /db_xref="GOA:E6V063"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:E6V063"
FT                   /inference="protein motif:PFAM:PF00614"
FT                   /protein_id="ADU34377.1"
FT                   /translation="MRASLIRGFTALVGVLAAAWLTGCVSLPPPEPRAPVTAFTDVANT
FT                   ELGQLAAKGVPGDSTALSGFRLLPEAAFAFDARISLARHAEKSLDVQYYLIQKDDVGLL
FT                   FLKELREAAARGVRVRLLVDDLYTAGEDEVFSSFSAFPNVEVRLFNPLPSRADSLATRL
FT                   LFSLTDFGRINHRMHNKMLIADNSFAVSGGRNIGNEYFMRSTAANFIDMDVISSGAVVR
FT                   QMSEGFDRYWNSSHAWPIERIAPLRTTPEAAQQRFDAIVRTAVPDVPIRPRDVLNKSPV
FT                   GEQLITGKIDRYWALGTLFVDDPEKITRKADDAYAGSVTEGALSVINSARREVKIGSPY
FT                   FIPGTRGMEMMKKAIESGGRITVITNSLGATDEPLAYAGYERYRADMLKIGVTIYEIAP
FT                   MLTARSGQFGDFGKTISRLHAKLAVIDDERFFVGSMNLDHRSAAVNTEVGLVIDSPELV
FT                   ADYNKLMNSQRINLGYRLRLAPNGRRVQWLEYDDAGGDIVHEDEPGEFLWLRFKNWLLL
FT                   PIVGEELL"
     MRASLIRGFT ALVGVLAAAW LTGCVSLPPP EPRAPVTAFT DVANTELGQL AAKGVPGDST        60
     ALSGFRLLPE AAFAFDARIS LARHAEKSLD VQYYLIQKDD VGLLFLKELR EAAARGVRVR       120
     LLVDDLYTAG EDEVFSSFSA FPNVEVRLFN PLPSRADSLA TRLLFSLTDF GRINHRMHNK       180
     MLIADNSFAV SGGRNIGNEY FMRSTAANFI DMDVISSGAV VRQMSEGFDR YWNSSHAWPI       240
     ERIAPLRTTP EAAQQRFDAI VRTAVPDVPI RPRDVLNKSP VGEQLITGKI DRYWALGTLF       300
     VDDPEKITRK ADDAYAGSVT EGALSVINSA RREVKIGSPY FIPGTRGMEM MKKAIESGGR       360
     ITVITNSLGA TDEPLAYAGY ERYRADMLKI GVTIYEIAPM LTARSGQFGD FGKTISRLHA       420
     KLAVIDDERF FVGSMNLDHR SAAVNTEVGL VIDSPELVAD YNKLMNSQRI NLGYRLRLAP       480
     NGRRVQWLEY DDAGGDIVHE DEPGEFLWLR FKNWLLLPIV GEELL                       525
//

If you have problems or comments...

PBIL Back to PBIL home page