(data stored in ACNUC1104 zone)

EMBL: CP002417.PE156

CP002417.PE156       Location/Qualifiers
FT   CDS             159455..159820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0157"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dar:Daro_0403 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34379"
FT                   /db_xref="GOA:E6V065"
FT                   /db_xref="UniProtKB/TrEMBL:E6V065"
FT                   /inference="similar to AA sequence:KEGG:Daro_0403"
FT                   /protein_id="ADU34379.1"
FT                   /translation="MVLDFCISFGLAAPVVLSVVLYQVGHRAVAQGRVGPVTASLVYGL
FT                   CVAALPLAVWWGVHALAEFYIVGEGTSFWKSVLQIGLAFLMYAYLCISWALSFVAACLA
FT                   TWRFTVCAKRLKQEALA"
     MVLDFCISFG LAAPVVLSVV LYQVGHRAVA QGRVGPVTAS LVYGLCVAAL PLAVWWGVHA        60
     LAEFYIVGEG TSFWKSVLQI GLAFLMYAYL CISWALSFVA ACLATWRFTV CAKRLKQEAL       120
     A                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page