(data stored in SCRATCH zone)

EMBL: CP002417.PE16

CP002417.PE16        Location/Qualifiers
FT   CDS             complement(15717..16790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0016"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="KEGG: vap:Vapar_0016 NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34239"
FT                   /db_xref="GOA:E6UXP5"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXP5"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0016"
FT                   /protein_id="ADU34239.1"
FT                   /translation="MSPTIRKGQAPETLQRAQFHDRFMQPFQDPAFKAESDSLQRIELI
FT                   AWEAYQEGRKAPVTRKAGPGYADPDYDLSVDWLEAKARIDAAQAVWGQPQTRSRVLLVN
FT                   GSPRNDGTCPGEISKTWRLTELAREVLEGSGVEADVLDLSHLTSEYGRHIHPCKACVST
FT                   AMPLCHWPCSCYPNHSLRQTGDWMNEIYERWVAAHGVILLTPTHWYQATSPLKLMIDRL
FT                   VCADGGNPDPTSTHGKKPEEAKALELQGWGYPKHLEGRVYGVVVHGDVAGVESVRRNLT
FT                   DWLDWMGLVDAGAQARLDRYIGYYEPYATSHDALDEDTDVQEEVRNVARAVARAVGELR
FT                   AGKLQSPDRGLKQPRPK"
     MSPTIRKGQA PETLQRAQFH DRFMQPFQDP AFKAESDSLQ RIELIAWEAY QEGRKAPVTR        60
     KAGPGYADPD YDLSVDWLEA KARIDAAQAV WGQPQTRSRV LLVNGSPRND GTCPGEISKT       120
     WRLTELAREV LEGSGVEADV LDLSHLTSEY GRHIHPCKAC VSTAMPLCHW PCSCYPNHSL       180
     RQTGDWMNEI YERWVAAHGV ILLTPTHWYQ ATSPLKLMID RLVCADGGNP DPTSTHGKKP       240
     EEAKALELQG WGYPKHLEGR VYGVVVHGDV AGVESVRRNL TDWLDWMGLV DAGAQARLDR       300
     YIGYYEPYAT SHDALDEDTD VQEEVRNVAR AVARAVGELR AGKLQSPDRG LKQPRPK          357
//

If you have problems or comments...

PBIL Back to PBIL home page