(data stored in SCRATCH zone)

EMBL: CP002417.PE160

CP002417.PE160       Location/Qualifiers
FT   CDS             complement(162274..163134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0161"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   pol:Bpro_5149 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34383"
FT                   /db_xref="GOA:E6V069"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E6V069"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADU34383.1"
FT                   /translation="MGIVIFDGVAYGMLLFLIGVGLSITMGLMNFVNLAHGSFAMVGGY
FT                   AASLLMNHWGLGFGLSLAAAFVSAALVGAVLEFVFYRRLYRAHPLDQVLLSIGVVFVSI
FT                   AAFTYFFGPTMQPFTLPPSLDGQVAIGGLEVGRYRLFLIVCGVAVLAALLLVLGKTRYG
FT                   AMVRAAVDNQRVAGGTGIHVQRLFFLTFSLGCGLAGLGGALSLGMLGLEPSFPLKYLVY
FT                   FLMVVCVGGAGTVTGPFIAALLVGIVDVAGKYYWPEAGAFLIYVFMIVMLLVRPNGIVA
FT                   KKGLA"
     MGIVIFDGVA YGMLLFLIGV GLSITMGLMN FVNLAHGSFA MVGGYAASLL MNHWGLGFGL        60
     SLAAAFVSAA LVGAVLEFVF YRRLYRAHPL DQVLLSIGVV FVSIAAFTYF FGPTMQPFTL       120
     PPSLDGQVAI GGLEVGRYRL FLIVCGVAVL AALLLVLGKT RYGAMVRAAV DNQRVAGGTG       180
     IHVQRLFFLT FSLGCGLAGL GGALSLGMLG LEPSFPLKYL VYFLMVVCVG GAGTVTGPFI       240
     AALLVGIVDV AGKYYWPEAG AFLIYVFMIV MLLVRPNGIV AKKGLA                      286
//

If you have problems or comments...

PBIL Back to PBIL home page