(data stored in ACNUC1104 zone)

EMBL: CP002417.PE162

CP002417.PE162       Location/Qualifiers
FT   CDS             complement(164418..164741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0163"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; KEGG: pol:Bpro_5152 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34385"
FT                   /db_xref="GOA:E6V071"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E6V071"
FT                   /inference="protein motif:PFAM:PF00111"
FT                   /protein_id="ADU34385.1"
FT                   /translation="MPTIHYILKDGSTRAVDAKIGASVMETAIRGNVRGIDAECGGCCS
FT                   CATCHVYVDEAFADLLPPPDDMESALLEVVASERQPNSRLSCQLTVTAAFDGLTVRVPE
FT                   SQV"
     MPTIHYILKD GSTRAVDAKI GASVMETAIR GNVRGIDAEC GGCCSCATCH VYVDEAFADL        60
     LPPPDDMESA LLEVVASERQ PNSRLSCQLT VTAAFDGLTV RVPESQV                     107
//

If you have problems or comments...

PBIL Back to PBIL home page