(data stored in ACNUC1104 zone)

EMBL: CP002417.PE163

CP002417.PE163       Location/Qualifiers
FT   CDS             complement(164757..166211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0164"
FT                   /product="glutamine synthetase catalytic region"
FT                   /note="PFAM: glutamine synthetase catalytic region; KEGG:
FT                   pol:Bpro_5153 L-glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34386"
FT                   /db_xref="GOA:E6V072"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:E6V072"
FT                   /inference="protein motif:PFAM:PF00120"
FT                   /protein_id="ADU34386.1"
FT                   /translation="MSSSNTNTFVDRFGLWSDDQHAQARELVRRIDSDEVDLVRFAWPD
FT                   QHGILRGKTLVATEARSALWEGVNLTSTLLAKDTSHKTVFPVFTTNGGFAIEGLQGGAD
FT                   FTIVADPATFKVLPWAPRTGWILCDAYMADGKPCPFATRQVLQRAVRQLDDLGLDFIAG
FT                   LEVEFHVFKLDDARMDLADSGQPGEPPRVSLLSHGHQYLTELRYDRVDGLMELLRSNLI
FT                   ALGLPLRSLEIEFGPSQFELTFGPTAGVMPADTMVLLRSAIKQICQRNGLHASFMCRPK
FT                   IPNVMSSGWHLHQSLRRKSDGVNAFMPETEGQDLSEIGMHYLGGLKAHACGAAALASPT
FT                   INGYRRYRPFSLAPDRAIWARDNRGAMLRVLGGVGQSASRIENRVGEPTANPYLYLASQ
FT                   LFSGLDGIRHKIDPGPSADAPYETPAEHLPRSLGDALACLRRDEMLNTQMGKVFIDYLC
FT                   HIKEAEIARFNLEVSEWEHREYFDMF"
     MSSSNTNTFV DRFGLWSDDQ HAQARELVRR IDSDEVDLVR FAWPDQHGIL RGKTLVATEA        60
     RSALWEGVNL TSTLLAKDTS HKTVFPVFTT NGGFAIEGLQ GGADFTIVAD PATFKVLPWA       120
     PRTGWILCDA YMADGKPCPF ATRQVLQRAV RQLDDLGLDF IAGLEVEFHV FKLDDARMDL       180
     ADSGQPGEPP RVSLLSHGHQ YLTELRYDRV DGLMELLRSN LIALGLPLRS LEIEFGPSQF       240
     ELTFGPTAGV MPADTMVLLR SAIKQICQRN GLHASFMCRP KIPNVMSSGW HLHQSLRRKS       300
     DGVNAFMPET EGQDLSEIGM HYLGGLKAHA CGAAALASPT INGYRRYRPF SLAPDRAIWA       360
     RDNRGAMLRV LGGVGQSASR IENRVGEPTA NPYLYLASQL FSGLDGIRHK IDPGPSADAP       420
     YETPAEHLPR SLGDALACLR RDEMLNTQMG KVFIDYLCHI KEAEIARFNL EVSEWEHREY       480
     FDMF                                                                    484
//

If you have problems or comments...

PBIL Back to PBIL home page