(data stored in ACNUC1104 zone)

EMBL: CP002417.PE164

CP002417.PE164       Location/Qualifiers
FT   CDS             complement(166223..167554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0165"
FT                   /product="Rieske (2Fe-2S) iron-sulfur domain"
FT                   /note="PFAM: Rieske [2Fe-2S] iron-sulphur domain; KEGG:
FT                   pol:Bpro_5154 Rieske (2Fe-2S) region"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34387"
FT                   /db_xref="GOA:E6V073"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:E6V073"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ADU34387.1"
FT                   /translation="MISAEQNDLITRVGPDAPAGKLLRRYWQPVALADELAGPRPVKPV
FT                   KLMGQDFVLFRDENGQLGMLDRDCPHRGADLAFGRLENGGIRCAFHGWLFDAKGNCLET
FT                   PAEPATSKLCSRIKQSAYPVVEKAGVVFAYIGEGEPPAFPDFDCFVAPDTHTFAFKGLF
FT                   ECNWLQALEVGIDPAHASYLHRFFEDEDTSESYGKQFRGASADSDMPITKVLREYDRPE
FT                   ISVEPAPYGFRLKALRKLSEDTTHVRVTNVVFPQAFVIPMSAEMTISQWHVPVDDTHCY
FT                   WYAIFTSFTGPVDKQQMRDQRLKLYELPDYTSRKNKRNNYGYSIDEQLTETYTGMGDDI
FT                   NVHDQWAVESQGAIQDRTREHLGSTDKGIIAYRRVLVKAIEATLAGETAPMLIDAAQAS
FT                   TMTGPPSIDGIGHVVDEAATETYWQEADRARRLKSDWASARLAA"
     MISAEQNDLI TRVGPDAPAG KLLRRYWQPV ALADELAGPR PVKPVKLMGQ DFVLFRDENG        60
     QLGMLDRDCP HRGADLAFGR LENGGIRCAF HGWLFDAKGN CLETPAEPAT SKLCSRIKQS       120
     AYPVVEKAGV VFAYIGEGEP PAFPDFDCFV APDTHTFAFK GLFECNWLQA LEVGIDPAHA       180
     SYLHRFFEDE DTSESYGKQF RGASADSDMP ITKVLREYDR PEISVEPAPY GFRLKALRKL       240
     SEDTTHVRVT NVVFPQAFVI PMSAEMTISQ WHVPVDDTHC YWYAIFTSFT GPVDKQQMRD       300
     QRLKLYELPD YTSRKNKRNN YGYSIDEQLT ETYTGMGDDI NVHDQWAVES QGAIQDRTRE       360
     HLGSTDKGII AYRRVLVKAI EATLAGETAP MLIDAAQAST MTGPPSIDGI GHVVDEAATE       420
     TYWQEADRAR RLKSDWASAR LAA                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page