(data stored in ACNUC1104 zone)

EMBL: CP002417.PE169

CP002417.PE169       Location/Qualifiers
FT   CDS             complement(170489..171469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0170"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: vap:Vapar_0145 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34392"
FT                   /db_xref="GOA:E6V078"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:E6V078"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU34392.1"
FT                   /translation="MDVNFRTLDLNLLRVFDEVMAERNLTRAARNLSITQPAVSNALRR
FT                   LREVIGDELVRRAGAGVEPTPRALALWPTVRDALRQLQHTLAPGEFDAATADTTFLLAM
FT                   ADATAAELIPGLVQIAEKEAPAISLRVLPLTTRDPRRMLENEEVDMAIGYFPAVIASLA
FT                   ARGQSGVGVPFETQRLYLGQYVCVMRRGHPLANAPLTLDDYCAARHLLVSFSGRPYGFI
FT                   DQTLGAMGRERRIVVTVNQFFTAGRVVANSDLLTVLPRHFVTVTGIDDQLVLRDLPFDQ
FT                   PPVHVDAIWHRRAQHGHAHEWLRTALLRSAAAAFAGSILGQKVPD"
     MDVNFRTLDL NLLRVFDEVM AERNLTRAAR NLSITQPAVS NALRRLREVI GDELVRRAGA        60
     GVEPTPRALA LWPTVRDALR QLQHTLAPGE FDAATADTTF LLAMADATAA ELIPGLVQIA       120
     EKEAPAISLR VLPLTTRDPR RMLENEEVDM AIGYFPAVIA SLAARGQSGV GVPFETQRLY       180
     LGQYVCVMRR GHPLANAPLT LDDYCAARHL LVSFSGRPYG FIDQTLGAMG RERRIVVTVN       240
     QFFTAGRVVA NSDLLTVLPR HFVTVTGIDD QLVLRDLPFD QPPVHVDAIW HRRAQHGHAH       300
     EWLRTALLRS AAAAFAGSIL GQKVPD                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page