(data stored in ACNUC1104 zone)

EMBL: CP002417.PE17

CP002417.PE17        Location/Qualifiers
FT   CDS             complement(16880..17776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0017"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; KEGG: vap:Vapar_0017
FT                   pirin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34240"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXP6"
FT                   /inference="protein motif:PFAM:PF02678"
FT                   /protein_id="ADU34240.1"
FT                   /translation="MGRMTKNANHPTEPVATPRGLDHIVAGVSTSDGDGVKLTRVLQQP
FT                   LQKRLDPYLMLDAFGSDNPGDYIGGFPNHPHRGFETVTYMIAGRMRHRDSAGHEGLLEN
FT                   GGVQWMTAGRGLVHSELPEQEEGLMEGFQLWLNLPAKDKMREPWYRDIQSEEIPEYTTA
FT                   EGVHVRVIAGTSHGIEGAVLRAHTEPLYLDLTLPPGAEFAQPLPADHNVLVYVFRESLW
FT                   IAGSEVPTRRMAILANDVGSDGVVLRAGATNHSPARALLIAGRPLHEPIAQYGPFVMNT
FT                   QEEVKQAVHDFQNGQLG"
     MGRMTKNANH PTEPVATPRG LDHIVAGVST SDGDGVKLTR VLQQPLQKRL DPYLMLDAFG        60
     SDNPGDYIGG FPNHPHRGFE TVTYMIAGRM RHRDSAGHEG LLENGGVQWM TAGRGLVHSE       120
     LPEQEEGLME GFQLWLNLPA KDKMREPWYR DIQSEEIPEY TTAEGVHVRV IAGTSHGIEG       180
     AVLRAHTEPL YLDLTLPPGA EFAQPLPADH NVLVYVFRES LWIAGSEVPT RRMAILANDV       240
     GSDGVVLRAG ATNHSPARAL LIAGRPLHEP IAQYGPFVMN TQEEVKQAVH DFQNGQLG         298
//

If you have problems or comments...

PBIL Back to PBIL home page