(data stored in ACNUC1104 zone)

EMBL: CP002417.PE171

CP002417.PE171       Location/Qualifiers
FT   CDS             complement(178319..180184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0172"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /note="KEGG: vap:Vapar_0147 phosphoenolpyruvate
FT                   carboxykinase; PFAM: phosphoenolpyruvate carboxykinase
FT                   (GTP)"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34394"
FT                   /db_xref="GOA:E6V080"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:E6V080"
FT                   /inference="protein motif:PRIAM:4.1.1.32"
FT                   /protein_id="ADU34394.1"
FT                   /translation="MNAPTMKGLTIQAPSYVKNAKLIAWVADMAALCKPESIYWCDGSK
FT                   EEYDRLCQQLVDAGTFKKLNPAKRPNSFLAVSDPTDVARVEDRTFICSNEKESAGPTNN
FT                   WMAPAEMRATLQPLFDGCMKGRTMYVVPFSMGPLGSPIAHIGIELSDSPYVAVNMRIMT
FT                   RMGKAVYEVLGADGEFVPCVHTVGAPLEAGQKDVSWPCNKTKYIVHYPETREIWSYGSG
FT                   YGGNALLGKKCFALRIASNMGRDEGWLAEHMLILGVTNPEGKKYHVAAAFPSACGKTNF
FT                   SMLVPPAGFEGWKVTTIGDDIAWIKPGKDGRLYAINPEAGYFGVAPGTNMLTNPNCMDS
FT                   LNSDVIFTNVALTDDGDVWWEGMEQDTKTLPEHLTDWQGKDWTPQIAKETGAKAAHPNS
FT                   RFTVAATNNPALDDAWDDPKGVAIDAFIFGGRRSTTVPLVTEAHNWVEGVYMAATMGSE
FT                   TTAAAGGQQGVVRRDPFAMLPFAGYNMADYFQHWLNVGKKLEASGAKLPKIYTTNWFRK
FT                   GADGKFVWPGYGENMRVLKWMIDRIEGKKTEGVEHITGVSPRYEDLNWTGLEFSAEQFA
FT                   TVTSIDKAAWQAELKLHAELFQQLSHHLPKELPETKAAIEQRLAA"
     MNAPTMKGLT IQAPSYVKNA KLIAWVADMA ALCKPESIYW CDGSKEEYDR LCQQLVDAGT        60
     FKKLNPAKRP NSFLAVSDPT DVARVEDRTF ICSNEKESAG PTNNWMAPAE MRATLQPLFD       120
     GCMKGRTMYV VPFSMGPLGS PIAHIGIELS DSPYVAVNMR IMTRMGKAVY EVLGADGEFV       180
     PCVHTVGAPL EAGQKDVSWP CNKTKYIVHY PETREIWSYG SGYGGNALLG KKCFALRIAS       240
     NMGRDEGWLA EHMLILGVTN PEGKKYHVAA AFPSACGKTN FSMLVPPAGF EGWKVTTIGD       300
     DIAWIKPGKD GRLYAINPEA GYFGVAPGTN MLTNPNCMDS LNSDVIFTNV ALTDDGDVWW       360
     EGMEQDTKTL PEHLTDWQGK DWTPQIAKET GAKAAHPNSR FTVAATNNPA LDDAWDDPKG       420
     VAIDAFIFGG RRSTTVPLVT EAHNWVEGVY MAATMGSETT AAAGGQQGVV RRDPFAMLPF       480
     AGYNMADYFQ HWLNVGKKLE ASGAKLPKIY TTNWFRKGAD GKFVWPGYGE NMRVLKWMID       540
     RIEGKKTEGV EHITGVSPRY EDLNWTGLEF SAEQFATVTS IDKAAWQAEL KLHAELFQQL       600
     SHHLPKELPE TKAAIEQRLA A                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page