(data stored in ACNUC1104 zone)

EMBL: CP002417.PE173

CP002417.PE173       Location/Qualifiers
FT   CDS             complement(180582..181790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0174"
FT                   /product="threonine dehydratase"
FT                   /note="KEGG: vap:Vapar_0149 threonine dehydratase; TIGRFAM:
FT                   threonine dehydratase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34396"
FT                   /db_xref="GOA:E6V082"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E6V082"
FT                   /inference="protein motif:TFAM:TIGR01127"
FT                   /protein_id="ADU34396.1"
FT                   /translation="MRAMVGIEEIRRAAVRLQGQVLNTPCVESRTLSEIVGAQVFLKFE
FT                   NLQFTSSFKERGACNKLVDLSEAGTRGVIAMSAGNHAQGVAYHAQRLGLRALIVMPRFT
FT                   PGVKIERTRGFGAEVVLHGDTLDAARAHALELAEREGLAFVHPYDDEAIIAGQGTVALE
FT                   MLDAVPDLDTLVVAVGGGGLIAGMAVAARDRKPGIEIVGVQTTRFPGMVNAIKGTHHAQ
FT                   GKSTIAEGIAVGTPGVLTQEIIASKVDDLVLVDEGDIEQGVLMLLEIEKTLVEGAGAAG
FT                   LAALIRHPERFKGKRVGLVLSGGNIDPLLLAAIIERGMVRAGRLARVRVSARDVPGSLA
FT                   EITATVAEAGANVDEVHHQRAFTMLAAQNVDIELVLQTRGRAHLASVLTALKDAGFEAE
FT                   EQH"
     MRAMVGIEEI RRAAVRLQGQ VLNTPCVESR TLSEIVGAQV FLKFENLQFT SSFKERGACN        60
     KLVDLSEAGT RGVIAMSAGN HAQGVAYHAQ RLGLRALIVM PRFTPGVKIE RTRGFGAEVV       120
     LHGDTLDAAR AHALELAERE GLAFVHPYDD EAIIAGQGTV ALEMLDAVPD LDTLVVAVGG       180
     GGLIAGMAVA ARDRKPGIEI VGVQTTRFPG MVNAIKGTHH AQGKSTIAEG IAVGTPGVLT       240
     QEIIASKVDD LVLVDEGDIE QGVLMLLEIE KTLVEGAGAA GLAALIRHPE RFKGKRVGLV       300
     LSGGNIDPLL LAAIIERGMV RAGRLARVRV SARDVPGSLA EITATVAEAG ANVDEVHHQR       360
     AFTMLAAQNV DIELVLQTRG RAHLASVLTA LKDAGFEAEE QH                          402
//

If you have problems or comments...

PBIL Back to PBIL home page