(data stored in SCRATCH zone)

EMBL: CP002417.PE174

CP002417.PE174       Location/Qualifiers
FT   CDS             181898..184222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0175"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="KEGG: vap:Vapar_0150 AAA ATPase central domain
FT                   protein; PFAM: AAA ATPase central domain protein; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34397"
FT                   /db_xref="GOA:E6V083"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V083"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ADU34397.1"
FT                   /translation="MVKRAGVDVVAAAVRGQALPSPGLKEAPVLELMCSHFVLTLAAKQ
FT                   GPRFNVRRDINGLLSLTGRHLVWPAPVLQRLREFLGRRCAGNEAWKGVENFDGRTLLER
FT                   HGVWRGPYEEGTLFFYLDEYAKDQPKDLLSVLAVTRDWLTHALRKQSTLVEKNIDALAG
FT                   LLQLNKAERALLLYGTLARYQRDLRSLLVEFKVNNAPEAYAAIADIAGVNASEVGEALR
FT                   AGSRLERIGLVENLISEHNITDLADLMKVSEKLPPVLMREYRDHNELMAVFTRPSAKSA
FT                   LTPHDFSFVEEDAQMLVTLLRAAVARKEPGVNVLLYGPPGTGKTELAKVVAQAAGLELF
FT                   EVEYADRDGNSLSGRDRYRSLQIAQVFLKGSAQAALLFDEVEDVFPPISTEAAQFMARA
FT                   EQIPSSTSGSVSGKAWVNQILEANPVPTLWVTNRIEQIDPAFRRRFAYHLELKSPPPGA
FT                   REQLVKKTLEGVVVSEAFTAKLAERKGLTPAQIRTAVRFAGLAKTDDASMEGLIERQLR
FT                   NADLALGTLDTGRGERRNVTTYDLDMLNVETRFEIPRIVEALKARGHGTLCFYGAPGTG
FT                   KTALAEHIARAVGRPLIIKQASDLMSKYVGETEQNMAAMFKEAEAEKAVLLLDEADSFL
FT                   QDRRGAQRTYEVTEVNEMLQGMERFNGVFVCTTNLLDRLDQAALRRFTFKIKFKPLTAA
FT                   QRERMFVTEALAGDAALLTGEVKTRLAQLAQLCPGDFAAVKRQTDILAVEFSAAEFLDQ
FT                   LEAEHRIKPEVRESRGMGFVQ"
     MVKRAGVDVV AAAVRGQALP SPGLKEAPVL ELMCSHFVLT LAAKQGPRFN VRRDINGLLS        60
     LTGRHLVWPA PVLQRLREFL GRRCAGNEAW KGVENFDGRT LLERHGVWRG PYEEGTLFFY       120
     LDEYAKDQPK DLLSVLAVTR DWLTHALRKQ STLVEKNIDA LAGLLQLNKA ERALLLYGTL       180
     ARYQRDLRSL LVEFKVNNAP EAYAAIADIA GVNASEVGEA LRAGSRLERI GLVENLISEH       240
     NITDLADLMK VSEKLPPVLM REYRDHNELM AVFTRPSAKS ALTPHDFSFV EEDAQMLVTL       300
     LRAAVARKEP GVNVLLYGPP GTGKTELAKV VAQAAGLELF EVEYADRDGN SLSGRDRYRS       360
     LQIAQVFLKG SAQAALLFDE VEDVFPPIST EAAQFMARAE QIPSSTSGSV SGKAWVNQIL       420
     EANPVPTLWV TNRIEQIDPA FRRRFAYHLE LKSPPPGARE QLVKKTLEGV VVSEAFTAKL       480
     AERKGLTPAQ IRTAVRFAGL AKTDDASMEG LIERQLRNAD LALGTLDTGR GERRNVTTYD       540
     LDMLNVETRF EIPRIVEALK ARGHGTLCFY GAPGTGKTAL AEHIARAVGR PLIIKQASDL       600
     MSKYVGETEQ NMAAMFKEAE AEKAVLLLDE ADSFLQDRRG AQRTYEVTEV NEMLQGMERF       660
     NGVFVCTTNL LDRLDQAALR RFTFKIKFKP LTAAQRERMF VTEALAGDAA LLTGEVKTRL       720
     AQLAQLCPGD FAAVKRQTDI LAVEFSAAEF LDQLEAEHRI KPEVRESRGM GFVQ             774
//

If you have problems or comments...

PBIL Back to PBIL home page