(data stored in ACNUC1104 zone)

EMBL: CP002417.PE176

CP002417.PE176       Location/Qualifiers
FT   CDS             186066..187256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0177"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /note="PFAM: Inosine/uridine-preferring nucleoside
FT                   hydrolase; KEGG: vap:Vapar_0152 inosine/uridine-preferring
FT                   nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34399"
FT                   /db_xref="GOA:E6V085"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:E6V085"
FT                   /inference="protein motif:PFAM:PF01156"
FT                   /protein_id="ADU34399.1"
FT                   /translation="MRKLHKWIGAVFALVAAAVVAGCGGGGDGNGGFGLAPGFGGPPPP
FT                   AQKIIIDSDYNTMSDDGQLGVMAAQLQAEGKVQVMGISVVSGNQWLKQGVADALMSVER
FT                   LGVGDRIGVYVGENYALNHTFADVEAEMAAGAGGDGYLGAWSGPEPKTDADLKPSPDGF
FT                   ATRTLVQRKSAVDFIIDTVKANPNEITILAIGPLTNIALAVKKSPDIIPLIKKIVYMGG
FT                   AIDVPGNTTKAAEFNWWFDPDAAQFVVRLPIPQVVVPLDVTDTVFLTKPIYDRIAHPAK
FT                   PTAVTEVFRKLNGYGFSGTNGFENNPDYTQNIWDTLTLAYLIDPTYATRTVERYVDVVA
FT                   KPGAADNGRSIGYASQPAGPTLQKMTVVQRFDNTRFFELFVDLLTRPVPITLPPAN"
     MRKLHKWIGA VFALVAAAVV AGCGGGGDGN GGFGLAPGFG GPPPPAQKII IDSDYNTMSD        60
     DGQLGVMAAQ LQAEGKVQVM GISVVSGNQW LKQGVADALM SVERLGVGDR IGVYVGENYA       120
     LNHTFADVEA EMAAGAGGDG YLGAWSGPEP KTDADLKPSP DGFATRTLVQ RKSAVDFIID       180
     TVKANPNEIT ILAIGPLTNI ALAVKKSPDI IPLIKKIVYM GGAIDVPGNT TKAAEFNWWF       240
     DPDAAQFVVR LPIPQVVVPL DVTDTVFLTK PIYDRIAHPA KPTAVTEVFR KLNGYGFSGT       300
     NGFENNPDYT QNIWDTLTLA YLIDPTYATR TVERYVDVVA KPGAADNGRS IGYASQPAGP       360
     TLQKMTVVQR FDNTRFFELF VDLLTRPVPI TLPPAN                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page