(data stored in ACNUC1104 zone)

EMBL: CP002417.PE177

CP002417.PE177       Location/Qualifiers
FT   CDS             complement(187275..189170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0178"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase RecQ;
FT                   ATP-dependent DNA helicase, RecQ family; PFAM: RQC domain;
FT                   DEAD/DEAH box helicase domain protein; helicase domain
FT                   protein; HRDC domain protein; KEGG: vap:Vapar_0153
FT                   ATP-dependent DNA helicase RecQ; SMART: DEAD-like helicase
FT                   ; helicase domain protein; HRDC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34400"
FT                   /db_xref="GOA:E6V086"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E6V086"
FT                   /inference="protein motif:TFAM:TIGR01389"
FT                   /protein_id="ADU34400.1"
FT                   /translation="MSSLAPHPLDAPGSSTSPAEILHEVFGYSQFRGAQQDIVDHVVGG
FT                   GDALVLMPTGGGKSLCYQIPAIARQRAGRGVAVVVSPLIALMHDQVGALHEAGVNAAFL
FT                   NSTLDWEQTQDVERRMLRGEITLLYAAPERVNTPRFLSQLDSLKERGKLSLFAIDEAHC
FT                   VSQWGHDFRPEYRALTVLHERYPGVPRIALTATADDLTRADIVERLQLEEARQFVSSFD
FT                   RPNIRYTIVEKKDATTQLLRFIEREHEGDAGVVYCQSRKRVEDLATTLQGAGINALPYH
FT                   AGLDAAVRQKHQDRFLREEGIVMVATIAFGMGIDKPDVRFVGHLDMPKNIEGYYQETGR
FT                   AGRDGAPADAWMTYGLNDVVNQRRMIDESPAGEEFKQVMRGKLDALLSLAEASDCRRVR
FT                   LLGYFGEKSTPCGNCDNCLNPPNVWDGTDAARKLLSTIYRVQQLSGISFGAGHIMDILR
FT                   GKETEKVKQFGHERISTFGLGAEFSEVQLRGVLRQLIATGALAVDAEAFNTLKLTEGSR
FT                   AVLKGEANVTLRESISSPAERKPRREKVAKGAPSPAAAKLDDTGKKRFEALKAWRAEVA
FT                   KEHNLPAYVIFHDATLASIAERAPATLEDLQGISGIGTKKLEAYGTEVLRVCSAF"
     MSSLAPHPLD APGSSTSPAE ILHEVFGYSQ FRGAQQDIVD HVVGGGDALV LMPTGGGKSL        60
     CYQIPAIARQ RAGRGVAVVV SPLIALMHDQ VGALHEAGVN AAFLNSTLDW EQTQDVERRM       120
     LRGEITLLYA APERVNTPRF LSQLDSLKER GKLSLFAIDE AHCVSQWGHD FRPEYRALTV       180
     LHERYPGVPR IALTATADDL TRADIVERLQ LEEARQFVSS FDRPNIRYTI VEKKDATTQL       240
     LRFIEREHEG DAGVVYCQSR KRVEDLATTL QGAGINALPY HAGLDAAVRQ KHQDRFLREE       300
     GIVMVATIAF GMGIDKPDVR FVGHLDMPKN IEGYYQETGR AGRDGAPADA WMTYGLNDVV       360
     NQRRMIDESP AGEEFKQVMR GKLDALLSLA EASDCRRVRL LGYFGEKSTP CGNCDNCLNP       420
     PNVWDGTDAA RKLLSTIYRV QQLSGISFGA GHIMDILRGK ETEKVKQFGH ERISTFGLGA       480
     EFSEVQLRGV LRQLIATGAL AVDAEAFNTL KLTEGSRAVL KGEANVTLRE SISSPAERKP       540
     RREKVAKGAP SPAAAKLDDT GKKRFEALKA WRAEVAKEHN LPAYVIFHDA TLASIAERAP       600
     ATLEDLQGIS GIGTKKLEAY GTEVLRVCSA F                                      631
//

If you have problems or comments...

PBIL Back to PBIL home page