(data stored in ACNUC1104 zone)

EMBL: CP002417.PE178

CP002417.PE178       Location/Qualifiers
FT   CDS             189474..190520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0179"
FT                   /product="extracellular solute-binding protein, family 3"
FT                   /note="KEGG: vap:Vapar_0154 extracellular solute-binding
FT                   protein, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34401"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:E6V087"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0154"
FT                   /protein_id="ADU34401.1"
FT                   /translation="MVKTVNISAPEPAAARQAPRGGQENLGRPGVFLKVASLLAAGACA
FT                   AGMAGTAAAQDTKIALGMSGWTGFAPLSLADKAGIFKKNGLDVELKMIPQKDRHLALAS
FT                   GAIQCAATTVETHVAWNANGVPIVQIFQMDKSYGADGIAVRNDVKTFADLKGKSIGVSA
FT                   PGTAPYFGLAWMLSKNGMSLKDVKVVSLEPQPAAQAFVAGQNDAAMTYEPYLSTVRANP
FT                   AAGKILATTLDYPMVMDTVGCAPTWLKANPKAAAALTKSYFDALDMIKADPAKSNELMG
FT                   SAVKQSGEQFAKSSAYLRWQDKAANQKFFAGELTTFMKEAAAILLEAGVIRKAPEDYAV
FT                   TFDASYVK"
     MVKTVNISAP EPAAARQAPR GGQENLGRPG VFLKVASLLA AGACAAGMAG TAAAQDTKIA        60
     LGMSGWTGFA PLSLADKAGI FKKNGLDVEL KMIPQKDRHL ALASGAIQCA ATTVETHVAW       120
     NANGVPIVQI FQMDKSYGAD GIAVRNDVKT FADLKGKSIG VSAPGTAPYF GLAWMLSKNG       180
     MSLKDVKVVS LEPQPAAQAF VAGQNDAAMT YEPYLSTVRA NPAAGKILAT TLDYPMVMDT       240
     VGCAPTWLKA NPKAAAALTK SYFDALDMIK ADPAKSNELM GSAVKQSGEQ FAKSSAYLRW       300
     QDKAANQKFF AGELTTFMKE AAAILLEAGV IRKAPEDYAV TFDASYVK                    348
//

If you have problems or comments...

PBIL Back to PBIL home page