(data stored in ACNUC1104 zone)

EMBL: CP002417.PE179

CP002417.PE179       Location/Qualifiers
FT   CDS             190501..191382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0180"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vap:Vapar_0155
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34402"
FT                   /db_xref="GOA:E6V088"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6V088"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU34402.1"
FT                   /translation="MQATSSKALPQQVPPRAASAGAASSQPVVPPVRRRAFAPLEPIGA
FT                   RARVLLGLGFFVVFVLVWSLATLGGFVSPTFLASPPTMVKEGWLLFTEYGFIGDIGMTV
FT                   WRVFGGFLLAAVFAVPLGIAMGTWKTVEAFFEPFVSFCRYLPASAFIPLLILWAGLGEM
FT                   QKLLVIFIGSFFQIVLMVAVTVGGARRDLVEAAYTLGANSRGIVARVLIPGAAPGIAET
FT                   LRLVLGWAWTYVIVAELIGSSSGIGHMITDSQALLNTGQIIFGIIVIGVIGLLSDFAFK
FT                   ALNRRLFAWAAL"
     MQATSSKALP QQVPPRAASA GAASSQPVVP PVRRRAFAPL EPIGARARVL LGLGFFVVFV        60
     LVWSLATLGG FVSPTFLASP PTMVKEGWLL FTEYGFIGDI GMTVWRVFGG FLLAAVFAVP       120
     LGIAMGTWKT VEAFFEPFVS FCRYLPASAF IPLLILWAGL GEMQKLLVIF IGSFFQIVLM       180
     VAVTVGGARR DLVEAAYTLG ANSRGIVARV LIPGAAPGIA ETLRLVLGWA WTYVIVAELI       240
     GSSSGIGHMI TDSQALLNTG QIIFGIIVIG VIGLLSDFAF KALNRRLFAW AAL              293
//

If you have problems or comments...

PBIL Back to PBIL home page