(data stored in SCRATCH zone)

EMBL: CP002417.PE18

CP002417.PE18        Location/Qualifiers
FT   CDS             complement(17865..19295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0018"
FT                   /product="Carotenoid oxygenase"
FT                   /note="PFAM: Carotenoid oxygenase; KEGG: bbt:BBta_5477
FT                   putative carotenoid oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34241"
FT                   /db_xref="GOA:E6UXP7"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXP7"
FT                   /inference="protein motif:PFAM:PF03055"
FT                   /protein_id="ADU34241.1"
FT                   /translation="MNDVTLPRNAPPPNMAPIDFETELGPLPLQGVLPEGLRGTLVRNG
FT                   PNPVVPDPKAHWFAGDGMLHSFTLADGQVHYRNRWLRTDLWRAATEGRDLTSSFQKARV
FT                   SDGPPPQHDGTGNTNVIAHAGRLLALEEAHLPIGFELPTLATLGATDFDGALSGAFTAH
FT                   PKTDPRTGELLFFGYGTPAKLSNGMSFGVISPEGRVTRFEHFEAPYASMVHDFMATDRH
FT                   VMFPIMPLTASMERAQSGRPPYAWEPEYGTRVGLMPRDGSTADIVWWRGPSCYAFHVMN
FT                   AWEADGSLFADVMQFATPPLFPKPDGSPASEITPQSWLVRWQFDLSNPSREFTQTRISD
FT                   VPGEFPRIDDRFAGLPYRHGWYTCHAETTPGGPPRLYAGLAHIDHAKPGTERDMYMFPA
FT                   PEVVSEGVFVPRSPDAEEGDGWLLATVWRSATNTSDLVIFDARALAKGPVCTVSLPHRV
FT                   PVGFHGNWFGEEHTEERT"
     MNDVTLPRNA PPPNMAPIDF ETELGPLPLQ GVLPEGLRGT LVRNGPNPVV PDPKAHWFAG        60
     DGMLHSFTLA DGQVHYRNRW LRTDLWRAAT EGRDLTSSFQ KARVSDGPPP QHDGTGNTNV       120
     IAHAGRLLAL EEAHLPIGFE LPTLATLGAT DFDGALSGAF TAHPKTDPRT GELLFFGYGT       180
     PAKLSNGMSF GVISPEGRVT RFEHFEAPYA SMVHDFMATD RHVMFPIMPL TASMERAQSG       240
     RPPYAWEPEY GTRVGLMPRD GSTADIVWWR GPSCYAFHVM NAWEADGSLF ADVMQFATPP       300
     LFPKPDGSPA SEITPQSWLV RWQFDLSNPS REFTQTRISD VPGEFPRIDD RFAGLPYRHG       360
     WYTCHAETTP GGPPRLYAGL AHIDHAKPGT ERDMYMFPAP EVVSEGVFVP RSPDAEEGDG       420
     WLLATVWRSA TNTSDLVIFD ARALAKGPVC TVSLPHRVPV GFHGNWFGEE HTEERT           476
//

If you have problems or comments...

PBIL Back to PBIL home page