(data stored in ACNUC1104 zone)

EMBL: CP002417.PE180

CP002417.PE180       Location/Qualifiers
FT   CDS             191367..192161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0181"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vap:Vapar_0156 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34403"
FT                   /db_xref="GOA:E6V089"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V089"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34403.1"
FT                   /translation="MGRTVKNQLSIQGVSRVFTGTKGQSTQALLPIDFEVKENDFVTIL
FT                   GPSGCGKSTLLRIVAGLDFPTTGQVLLDGERIEGPGADRGVVFQSYTLFPWLTVAQNIR
FT                   FGLRERGMSEADQKERSEFFIAKVGLRGFEHHFPKQLSGGMQQRTAIARALANDPKMLL
FT                   LDEPFGALDNQTRVLMQELLLGIWESAQKTVLFVTHDIDEAIFMANRVAVFSARPGRIK
FT                   TEIAVDFPHPRSYTIKTSPEFMDIKARLTEEIRAESMAAAEH"
     MGRTVKNQLS IQGVSRVFTG TKGQSTQALL PIDFEVKEND FVTILGPSGC GKSTLLRIVA        60
     GLDFPTTGQV LLDGERIEGP GADRGVVFQS YTLFPWLTVA QNIRFGLRER GMSEADQKER       120
     SEFFIAKVGL RGFEHHFPKQ LSGGMQQRTA IARALANDPK MLLLDEPFGA LDNQTRVLMQ       180
     ELLLGIWESA QKTVLFVTHD IDEAIFMANR VAVFSARPGR IKTEIAVDFP HPRSYTIKTS       240
     PEFMDIKARL TEEIRAESMA AAEH                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page