(data stored in ACNUC1104 zone)

EMBL: CP002417.PE181

CP002417.PE181       Location/Qualifiers
FT   CDS             192172..192909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0182"
FT                   /product="transcriptional regulator, histidine utilization
FT                   repressor, GntR family"
FT                   /note="TIGRFAM: histidine utilization repressor; PFAM: UbiC
FT                   transcription regulator-associated domain-containing
FT                   protein; regulatory protein GntR HTH; KEGG: vap:Vapar_0157
FT                   transcriptional regulator, histidine utilization repressor,
FT                   GntR family; SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34404"
FT                   /db_xref="GOA:E6V090"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR010248"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V090"
FT                   /inference="protein motif:TFAM:TIGR02018"
FT                   /protein_id="ADU34404.1"
FT                   /translation="MKRDLPTLALYAQVKDHISRKIQDGTWPPGHRLPSEHELVAQFGM
FT                   ARMTVNRALRELVEQGRIVRVAGVGSFVAENKPQSTLLQIANIASEIRQRGHDYRCEML
FT                   AVERIAASPDVAAWLDLRAGDSVFHSACLHLENDTPVQLEERYVNPQVVPDYLEQDFSA
FT                   MPPSEYLVRNVPFDQIEHVVDAVLPNAEQAERLAMDVTDPCLLLTRRTWTRNTPVTWVR
FT                   CLHPASRYSLGSRFRADGNPSFG"
     MKRDLPTLAL YAQVKDHISR KIQDGTWPPG HRLPSEHELV AQFGMARMTV NRALRELVEQ        60
     GRIVRVAGVG SFVAENKPQS TLLQIANIAS EIRQRGHDYR CEMLAVERIA ASPDVAAWLD       120
     LRAGDSVFHS ACLHLENDTP VQLEERYVNP QVVPDYLEQD FSAMPPSEYL VRNVPFDQIE       180
     HVVDAVLPNA EQAERLAMDV TDPCLLLTRR TWTRNTPVTW VRCLHPASRY SLGSRFRADG       240
     NPSFG                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page