(data stored in ACNUC1104 zone)

EMBL: CP002417.PE183

CP002417.PE183       Location/Qualifiers
FT   CDS             194567..196294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0184"
FT                   /product="urocanate hydratase"
FT                   /EC_number="4.2.1.49"
FT                   /note="TIGRFAM: urocanate hydratase; KEGG: vap:Vapar_0159
FT                   urocanate hydratase; PFAM: Urocanase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34406"
FT                   /db_xref="GOA:E6V092"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/TrEMBL:E6V092"
FT                   /inference="protein motif:TFAM:TIGR01228"
FT                   /protein_id="ADU34406.1"
FT                   /translation="MNAPEKFALNNPDAADPRHDPTRVIRAPRGSELNCKSWLTEAPFR
FT                   MLQNNLDAEVAERPQDLVVYGGIGRAARNWECYDQILASLKELNDDETLLIQSGKPVGV
FT                   FKTHENAPRVLLANSNLVPKWGTWEHFNELDRKGLFMYGQMTAGSWIYIGSQGIVQGTF
FT                   ETFVEAGRQHYNNSLAGKWILTAGLGGMGGAQPLAATLAGAVSLNIECQQSSIDFRLRT
FT                   RYVDKQARDIDHAFELIKQHCDAKEAVSIALLGNAADILPELVKRAKAGAHKPDLVTDQ
FT                   TSAHDLINGYLPSGWTVQQWQAAMKDVSQHDALKKAAAKSCAVHVQAMLDFQSMGIPTV
FT                   DYGNNIRQVAFDEGVKNAFDFPGFVPAYIRPLFCEGKGPFRWVALSGDPEDIYKTDAKI
FT                   KELFPENTHTHRWLDMARERIAFQGLPARICWLGLGERHIAGLAFNEMVKNGELKAPIV
FT                   IGRDHLDTGSVASPNRETEAMKDGTDAVSDWPLLNALLNTAGGATWVSLHHGGGVGMGY
FT                   SQHSGVVIVCDGTDAAAKRIERVLFNDPATGVMRHADAGYDIAIATAKKQGLKLPMVR"
     MNAPEKFALN NPDAADPRHD PTRVIRAPRG SELNCKSWLT EAPFRMLQNN LDAEVAERPQ        60
     DLVVYGGIGR AARNWECYDQ ILASLKELND DETLLIQSGK PVGVFKTHEN APRVLLANSN       120
     LVPKWGTWEH FNELDRKGLF MYGQMTAGSW IYIGSQGIVQ GTFETFVEAG RQHYNNSLAG       180
     KWILTAGLGG MGGAQPLAAT LAGAVSLNIE CQQSSIDFRL RTRYVDKQAR DIDHAFELIK       240
     QHCDAKEAVS IALLGNAADI LPELVKRAKA GAHKPDLVTD QTSAHDLING YLPSGWTVQQ       300
     WQAAMKDVSQ HDALKKAAAK SCAVHVQAML DFQSMGIPTV DYGNNIRQVA FDEGVKNAFD       360
     FPGFVPAYIR PLFCEGKGPF RWVALSGDPE DIYKTDAKIK ELFPENTHTH RWLDMARERI       420
     AFQGLPARIC WLGLGERHIA GLAFNEMVKN GELKAPIVIG RDHLDTGSVA SPNRETEAMK       480
     DGTDAVSDWP LLNALLNTAG GATWVSLHHG GGVGMGYSQH SGVVIVCDGT DAAAKRIERV       540
     LFNDPATGVM RHADAGYDIA IATAKKQGLK LPMVR                                  575
//

If you have problems or comments...

PBIL Back to PBIL home page