(data stored in ACNUC1104 zone)

EMBL: CP002417.PE188

CP002417.PE188       Location/Qualifiers
FT   CDS             199918..200490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0189"
FT                   /product="protein of unknown function DUF886"
FT                   /note="PFAM: protein of unknown function DUF886; KEGG:
FT                   vap:Vapar_0163 protein of unknown function DUF886"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34411"
FT                   /db_xref="InterPro:IPR010282"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E6V097"
FT                   /inference="protein motif:PFAM:PF05962"
FT                   /protein_id="ADU34411.1"
FT                   /translation="MNDVHRFSRSSLPAMPWKNGGGTTQEIASWPQGAALDSFGWRVSI
FT                   ATIAAAGPFSVFPGIARSIMLLEGDGVRLFTHDGRVEHRLDVPHRPFAFSGEDAIDCTL
FT                   LGGASNDFNVMTRHGQWRADVQVLDRATAIEAAPHGVLLALRGAWRLNDERCTEGEGLH
FT                   WADASLAWQAAPESEDARLVAVRIVPA"
     MNDVHRFSRS SLPAMPWKNG GGTTQEIASW PQGAALDSFG WRVSIATIAA AGPFSVFPGI        60
     ARSIMLLEGD GVRLFTHDGR VEHRLDVPHR PFAFSGEDAI DCTLLGGASN DFNVMTRHGQ       120
     WRADVQVLDR ATAIEAAPHG VLLALRGAWR LNDERCTEGE GLHWADASLA WQAAPESEDA       180
     RLVAVRIVPA                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page