(data stored in ACNUC1104 zone)

EMBL: CP002417.PE189

CP002417.PE189       Location/Qualifiers
FT   CDS             200511..201773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0190"
FT                   /product="imidazolonepropionase"
FT                   /EC_number="3.5.2.7"
FT                   /note="TIGRFAM: imidazolonepropionase; KEGG: vap:Vapar_0164
FT                   imidazolonepropionase; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34412"
FT                   /db_xref="GOA:E6V098"
FT                   /db_xref="InterPro:IPR005920"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E6V098"
FT                   /inference="protein motif:TFAM:TIGR01224"
FT                   /protein_id="ADU34412.1"
FT                   /translation="MKPANEYPSADGLWTGLRLATDAGAEAAIVVVEGAIRWVGARSAL
FT                   PAEFAGLAVHNGGDSLVTPGLVDCHTHLVYGGQRANEFAMRLAGATYEEVAKAGGGIVS
FT                   SVRATREADEDTLFAQAAPRLEQLLADGVCAIEIKSGYGLSLEHERKQLRVARRLGEAY
FT                   GVTVRTTFLGAHALPPEYTGRSGDYIDLVCREMLPALAAEGLVDAVDVFCERIAFSLEE
FT                   TEQVFQVAKALGLPVKLHAEQLSDMGGAALAARYGALSCDHIEHLSADGIEAMRQSGTV
FT                   AVLLPGAYYTLRDTHLPPIEALRTAGVPMAVSTDHNPGTSPTLSLLLMVNMACTLFRLT
FT                   VPEALAGVTVHAARALGLEATHGAIAEGMPANFVLWNVRDAAELAYWFGQRPLRTAVRQ
FT                   GRICISFPSPFGRGQGEGLRP"
     MKPANEYPSA DGLWTGLRLA TDAGAEAAIV VVEGAIRWVG ARSALPAEFA GLAVHNGGDS        60
     LVTPGLVDCH THLVYGGQRA NEFAMRLAGA TYEEVAKAGG GIVSSVRATR EADEDTLFAQ       120
     AAPRLEQLLA DGVCAIEIKS GYGLSLEHER KQLRVARRLG EAYGVTVRTT FLGAHALPPE       180
     YTGRSGDYID LVCREMLPAL AAEGLVDAVD VFCERIAFSL EETEQVFQVA KALGLPVKLH       240
     AEQLSDMGGA ALAARYGALS CDHIEHLSAD GIEAMRQSGT VAVLLPGAYY TLRDTHLPPI       300
     EALRTAGVPM AVSTDHNPGT SPTLSLLLMV NMACTLFRLT VPEALAGVTV HAARALGLEA       360
     THGAIAEGMP ANFVLWNVRD AAELAYWFGQ RPLRTAVRQG RICISFPSPF GRGQGEGLRP       420
//

If you have problems or comments...

PBIL Back to PBIL home page