(data stored in SCRATCH zone)

EMBL: CP002417.PE190

CP002417.PE190       Location/Qualifiers
FT   CDS             201770..203221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0191"
FT                   /product="formiminoglutamate deiminase"
FT                   /EC_number="3.5.4.28"
FT                   /note="TIGRFAM: formiminoglutamate deiminase; KEGG:
FT                   vap:Vapar_0165 N-formimino-L-glutamate deiminase; PFAM:
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34413"
FT                   /db_xref="GOA:E6V099"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR010252"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E6V099"
FT                   /inference="protein motif:TFAM:TIGR02022"
FT                   /protein_id="ADU34413.1"
FT                   /translation="MNTTTALSKADGPHPNPLPEGKGARQTLFAADALLPAGWTKNVLL
FT                   TWSDAGRLTQVQSTAQPPAGVQVATGPVIPGMPNLHSHAFQRAFAGLTEHRAEQHDSFW
FT                   SWRTLMYRFAARLGPQHMEAIATWLYAEMLEAGYTSVCEFQYVHHDADGRPYADDATLS
FT                   LALLRAAQKTGIGFTLLPVLYQTSGFGDQPPSEGQRRFVRSTESMLRLLEALKPACDAQ
FT                   GARLGLAPHSLRAVPPEALRDAVAGLEAVDRTAPIHIHIAEQTKEVDDCVAWSGLRPVE
FT                   WLLDHAPVDARWCLVHATHMNDAEYEYAAKSGAVAGLCPTTEANLGDGIFDFSKWRSHG
FT                   GAWGVGSDSHASVNAAEELLMLEYSQRLAKRQRNVGASAAQPHVATALTLEAVQGGAQA
FT                   SGRATGGLAAGQQADFVVLDAAHVALQGLSAPDMLSAHVFASHRTSAIDTVWVAGRKRV
FT                   SGGRHTLHAESVSAFVAARTQLLQD"
     MNTTTALSKA DGPHPNPLPE GKGARQTLFA ADALLPAGWT KNVLLTWSDA GRLTQVQSTA        60
     QPPAGVQVAT GPVIPGMPNL HSHAFQRAFA GLTEHRAEQH DSFWSWRTLM YRFAARLGPQ       120
     HMEAIATWLY AEMLEAGYTS VCEFQYVHHD ADGRPYADDA TLSLALLRAA QKTGIGFTLL       180
     PVLYQTSGFG DQPPSEGQRR FVRSTESMLR LLEALKPACD AQGARLGLAP HSLRAVPPEA       240
     LRDAVAGLEA VDRTAPIHIH IAEQTKEVDD CVAWSGLRPV EWLLDHAPVD ARWCLVHATH       300
     MNDAEYEYAA KSGAVAGLCP TTEANLGDGI FDFSKWRSHG GAWGVGSDSH ASVNAAEELL       360
     MLEYSQRLAK RQRNVGASAA QPHVATALTL EAVQGGAQAS GRATGGLAAG QQADFVVLDA       420
     AHVALQGLSA PDMLSAHVFA SHRTSAIDTV WVAGRKRVSG GRHTLHAESV SAFVAARTQL       480
     LQD                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page