(data stored in ACNUC1104 zone)

EMBL: CP002417.PE191

CP002417.PE191       Location/Qualifiers
FT   CDS             203229..204044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0192"
FT                   /product="N-formylglutamate amidohydrolase"
FT                   /note="KEGG: vap:Vapar_0166 N-formylglutamate
FT                   amidohydrolase; TIGRFAM: N-formylglutamate amidohydrolase;
FT                   PFAM: N-formylglutamate amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34414"
FT                   /db_xref="GOA:E6V0A0"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="InterPro:IPR010247"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0A0"
FT                   /inference="protein motif:TFAM:TIGR02017"
FT                   /protein_id="ADU34414.1"
FT                   /translation="MAFTTAEPAFRFRQGARPLLISMPHVGTHVPPALAARLTDEARHV
FT                   PDTDWHLEQLYDFADELGASVLVATHSRYVIDLNRPPDGASLYPGQSVTGLCPVDTFDD
FT                   TPVYASKDDLPSDAEVAERRDAIWHPYHRQLQAELDRLKAAHGTIALWDAHSIRSVLPR
FT                   FFEGKLPDLNLGTGNGTSCDPALAATLLGIAESATGYTGVLNGRFKGGHITRQYGNPAG
FT                   GVHAVQLEMTQSSYMQEKLPFDYLPAVAAGVQPHVRRMLEAVLAFVEKK"
     MAFTTAEPAF RFRQGARPLL ISMPHVGTHV PPALAARLTD EARHVPDTDW HLEQLYDFAD        60
     ELGASVLVAT HSRYVIDLNR PPDGASLYPG QSVTGLCPVD TFDDTPVYAS KDDLPSDAEV       120
     AERRDAIWHP YHRQLQAELD RLKAAHGTIA LWDAHSIRSV LPRFFEGKLP DLNLGTGNGT       180
     SCDPALAATL LGIAESATGY TGVLNGRFKG GHITRQYGNP AGGVHAVQLE MTQSSYMQEK       240
     LPFDYLPAVA AGVQPHVRRM LEAVLAFVEK K                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page