(data stored in ACNUC1104 zone)

EMBL: CP002417.PE193

CP002417.PE193       Location/Qualifiers
FT   CDS             205110..206159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0194"
FT                   /product="homocysteine S-methyltransferase"
FT                   /note="PFAM: homocysteine S-methyltransferase; KEGG:
FT                   vap:Vapar_0167 homocysteine S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34416"
FT                   /db_xref="GOA:E6V0A2"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0A2"
FT                   /inference="protein motif:PFAM:PF02574"
FT                   /protein_id="ADU34416.1"
FT                   /translation="MKPLVYTRGQALAGILEKRIAILDGAMGTMIQRFKLTEEQYRGER
FT                   FKDFERDVKGNNELLSLTRPDVISDIHEGYLAAGADLIETNTFGATTIAQEDYKMAHLA
FT                   REMNLESARIARAACDKFSTPDKPRFVAGALGPTPKTASISPDVNDPGARNVDFEQLRA
FT                   AYYEQTEALVEGGADVILVETIFDTLNAKAALFAVDEYFDNSGERLPLIISGTVTDASG
FT                   RILSGQTVTAFWHSVRHARPLAIGLNCALGAALMRPYIQELARVAGDTFISCYPNAGLP
FT                   NPMSDTGFDETPDVTSRLLHEFAAEGLVNIVGGCCGTTPDHIAAIGRAVAPVPGRLLNN
FT                   TAGFYSEAA"
     MKPLVYTRGQ ALAGILEKRI AILDGAMGTM IQRFKLTEEQ YRGERFKDFE RDVKGNNELL        60
     SLTRPDVISD IHEGYLAAGA DLIETNTFGA TTIAQEDYKM AHLAREMNLE SARIARAACD       120
     KFSTPDKPRF VAGALGPTPK TASISPDVND PGARNVDFEQ LRAAYYEQTE ALVEGGADVI       180
     LVETIFDTLN AKAALFAVDE YFDNSGERLP LIISGTVTDA SGRILSGQTV TAFWHSVRHA       240
     RPLAIGLNCA LGAALMRPYI QELARVAGDT FISCYPNAGL PNPMSDTGFD ETPDVTSRLL       300
     HEFAAEGLVN IVGGCCGTTP DHIAAIGRAV APVPGRLLNN TAGFYSEAA                   349
//

If you have problems or comments...

PBIL Back to PBIL home page