(data stored in ACNUC1104 zone)

EMBL: CP002417.PE194

CP002417.PE194       Location/Qualifiers
FT   CDS             206173..206481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0195"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_3374 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0A3"
FT                   /inference="similar to AA sequence:KEGG:Bpro_3374"
FT                   /protein_id="ADU34417.1"
FT                   /translation="MGAAGLRFAGLALVMSALAAGCNDTGKPPSWDTLLSGRIADARPD
FT                   CKVSVPLPGKITVACPGLKPAIFDVAPTAAYCQRGPRDCEFAVAQMVLMLPLPSPAP"
     MGAAGLRFAG LALVMSALAA GCNDTGKPPS WDTLLSGRIA DARPDCKVSV PLPGKITVAC        60
     PGLKPAIFDV APTAAYCQRG PRDCEFAVAQ MVLMLPLPSP AP                          102
//

If you have problems or comments...

PBIL Back to PBIL home page