(data stored in ACNUC1104 zone)

EMBL: CP002417.PE196

CP002417.PE196       Location/Qualifiers
FT   CDS             207578..208051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0197"
FT                   /product="transmembrane pair domain-containing protein"
FT                   /note="PFAM: transmembrane pair domain-containing protein;
FT                   KEGG: vap:Vapar_0170 transmembrane pair domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34419"
FT                   /db_xref="GOA:E6V0A5"
FT                   /db_xref="InterPro:IPR007896"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0A5"
FT                   /inference="protein motif:PFAM:PF05232"
FT                   /protein_id="ADU34419.1"
FT                   /translation="MQGLQRRVVYISLYEGIAIVCASAGLALMTDAGLGHSGVLAVAAS
FT                   VVAVIWNLIFNALFERWESRQAVRGRSVRRRIAHAIGFEGGLIAFLVPLFAWGLGVTLW
FT                   QALVMDLGLVLFFLVYTFVFNWGFDRVFGLPRSAQALPSAMPAPRSGASAPAR"
     MQGLQRRVVY ISLYEGIAIV CASAGLALMT DAGLGHSGVL AVAASVVAVI WNLIFNALFE        60
     RWESRQAVRG RSVRRRIAHA IGFEGGLIAF LVPLFAWGLG VTLWQALVMD LGLVLFFLVY       120
     TFVFNWGFDR VFGLPRSAQA LPSAMPAPRS GASAPAR                                157
//

If you have problems or comments...

PBIL Back to PBIL home page