(data stored in ACNUC1104 zone)

EMBL: CP002417.PE198

CP002417.PE198       Location/Qualifiers
FT   CDS             complement(208936..209973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0199"
FT                   /product="Triacylglycerol lipase"
FT                   /EC_number="3.1.1.3"
FT                   /note="KEGG: aav:Aave_4189 triacylglycerol lipase; PFAM:
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34421"
FT                   /db_xref="GOA:E6V0A7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0A7"
FT                   /inference="protein motif:PRIAM:3.1.1.3"
FT                   /protein_id="ADU34421.1"
FT                   /translation="MPRKRNSRLLRLAARPVCAALLLGLVGTTTLSQAAITDTPTQVQA
FT                   RVTSSEAKTKNPIVLVHGLFGFDNVLGIDYFYRIPESLAGAGAKVYVAQVSGANSSEIR
FT                   GEQLIQELKNLRALSGNPSLKFNLVGHSQGAPTARYVAAVEPGLVASVTSVGGANGGSK
FT                   VADLLRKIPEGSVSEAVVAETLRLAMLLLGAISGKDPSQLPEVPLNALNSLTTAGGAAF
FT                   DKKFPQGRPAPGSSCDVKSGPAEANGVRYYSWSGVQPLTNAFDASDVAMGGLSLIAFGS
FT                   ETNDGLLAVCSTRLGTHLGDYRQNHLDEVNQLFGLTYIGLWTLFEKKPVQLYQEQAARL
FT                   KSAGL"
     MPRKRNSRLL RLAARPVCAA LLLGLVGTTT LSQAAITDTP TQVQARVTSS EAKTKNPIVL        60
     VHGLFGFDNV LGIDYFYRIP ESLAGAGAKV YVAQVSGANS SEIRGEQLIQ ELKNLRALSG       120
     NPSLKFNLVG HSQGAPTARY VAAVEPGLVA SVTSVGGANG GSKVADLLRK IPEGSVSEAV       180
     VAETLRLAML LLGAISGKDP SQLPEVPLNA LNSLTTAGGA AFDKKFPQGR PAPGSSCDVK       240
     SGPAEANGVR YYSWSGVQPL TNAFDASDVA MGGLSLIAFG SETNDGLLAV CSTRLGTHLG       300
     DYRQNHLDEV NQLFGLTYIG LWTLFEKKPV QLYQEQAARL KSAGL                       345
//

If you have problems or comments...

PBIL Back to PBIL home page