(data stored in ACNUC1104 zone)

EMBL: CP002417.PE199

CP002417.PE199       Location/Qualifiers
FT   CDS             210246..212993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0200"
FT                   /product="methionine synthase"
FT                   /EC_number="2.1.1.13"
FT                   /note="TIGRFAM: methionine synthase; KEGG: vap:Vapar_0171
FT                   methionine synthase; PFAM: dihydropteroate synthase DHPS;
FT                   Methionine synthase B12-binding module cap domain protein;
FT                   cobalamin B12-binding domain protein; Vitamin B12 dependent
FT                   methionine synthase activation region"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34422"
FT                   /db_xref="GOA:E6V0A8"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0A8"
FT                   /inference="protein motif:TFAM:TIGR02082"
FT                   /protein_id="ADU34422.1"
FT                   /translation="MAQTPQISVPPMKLSGLEPVAIGEGTLFVNIGERTNVTGSKAFAR
FT                   MILNGQFEEALAVARQQVENGAQVIDINMDEAMLDSKVAMVRFLNLIASEPDIARVPVM
FT                   VDSSKWDVIEAGLRCIQGKGIVNSISMKEGVDKFKHEAKLVKRYGAAAVVMAFDEKGQA
FT                   DTYERKVEICERAYRILVDEVGFPPEDIIFDPNIFAIATGIEEHDNYAVDFINAVRWIK
FT                   ENLPGAKVSGGVSNVSFSFRGNDPMREAIHTVFLYHAIKAGMDMGIVNAGMVGVYDDLE
FT                   PELRERVEDVVLNRRPDAGERLVEVAETAKSGAKDESKRLEWRGTPESPVHVNQRLSHA
FT                   MVHGITDFIVEDTEEAYQQILAKGGRPLHVIEGPLMDGMNIVGDLFGAGKMFLPQVVKS
FT                   ARVMKSAVAHLLPYIEEEKLRDEAAGRDVRTKGKIIIATVKGDVHDIGKNIVTVVLQCN
FT                   NFEVVNMGVMVPCHEILARAKVEGADIVGLSGLITPSLEEMQYVAGEMQRDDHFRIKKI
FT                   PLMIGGATTSRVHTAVKIAPHYEGPVVYVPDASRSVSVAQSLLSDQATAYIDEINADYE
FT                   KVRTQHANKKQVPMWPLAKARANKTPIDWTNYVPPVPKFIGRRVFKNFDLTELAKYIDW
FT                   GPFFQTWDLAGPFPAILKDEVVGTEAVRVYADGQRMLKRLIEGRWLSASGIVGFWPANT
FT                   VNDDDIELYTDETRSEVALTWYGMRQQTEKQMIDGVMRPSRCLADFVAPKDSGLKDYVG
FT                   VFAVTAGLGVEKKEKYFIDDLDDYSAIMLKALADRLAEAFAESLHHRSRTDLWGYAPDE
FT                   GLSNEDMIGEKYRGIRPAPGYPACPDHSVKGPMFDLLACADIGMTLTESLAMMPAASVS
FT                   GFYLSHPDATYFNVGKIGHDQLQDQAARRKESESDLERLLAPNL"
     MAQTPQISVP PMKLSGLEPV AIGEGTLFVN IGERTNVTGS KAFARMILNG QFEEALAVAR        60
     QQVENGAQVI DINMDEAMLD SKVAMVRFLN LIASEPDIAR VPVMVDSSKW DVIEAGLRCI       120
     QGKGIVNSIS MKEGVDKFKH EAKLVKRYGA AAVVMAFDEK GQADTYERKV EICERAYRIL       180
     VDEVGFPPED IIFDPNIFAI ATGIEEHDNY AVDFINAVRW IKENLPGAKV SGGVSNVSFS       240
     FRGNDPMREA IHTVFLYHAI KAGMDMGIVN AGMVGVYDDL EPELRERVED VVLNRRPDAG       300
     ERLVEVAETA KSGAKDESKR LEWRGTPESP VHVNQRLSHA MVHGITDFIV EDTEEAYQQI       360
     LAKGGRPLHV IEGPLMDGMN IVGDLFGAGK MFLPQVVKSA RVMKSAVAHL LPYIEEEKLR       420
     DEAAGRDVRT KGKIIIATVK GDVHDIGKNI VTVVLQCNNF EVVNMGVMVP CHEILARAKV       480
     EGADIVGLSG LITPSLEEMQ YVAGEMQRDD HFRIKKIPLM IGGATTSRVH TAVKIAPHYE       540
     GPVVYVPDAS RSVSVAQSLL SDQATAYIDE INADYEKVRT QHANKKQVPM WPLAKARANK       600
     TPIDWTNYVP PVPKFIGRRV FKNFDLTELA KYIDWGPFFQ TWDLAGPFPA ILKDEVVGTE       660
     AVRVYADGQR MLKRLIEGRW LSASGIVGFW PANTVNDDDI ELYTDETRSE VALTWYGMRQ       720
     QTEKQMIDGV MRPSRCLADF VAPKDSGLKD YVGVFAVTAG LGVEKKEKYF IDDLDDYSAI       780
     MLKALADRLA EAFAESLHHR SRTDLWGYAP DEGLSNEDMI GEKYRGIRPA PGYPACPDHS       840
     VKGPMFDLLA CADIGMTLTE SLAMMPAASV SGFYLSHPDA TYFNVGKIGH DQLQDQAARR       900
     KESESDLERL LAPNL                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page