(data stored in SCRATCH zone)

EMBL: CP002417.PE202

CP002417.PE202       Location/Qualifiers
FT   CDS             215840..216229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0203"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: vap:Vapar_0174 GtrA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34425"
FT                   /db_xref="GOA:E6V0B1"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0B1"
FT                   /inference="protein motif:PFAM:PF04138"
FT                   /protein_id="ADU34425.1"
FT                   /translation="MKLGREFLSFAVVGAAGFVVDVAVLYLTAPLLGWYGARVLSFLAA
FT                   ATATWALNRRYTFSARSANASVLREYLGYLVTMLGGAVVNYGAYVLVLHWVTGAWAPAA
FT                   GVALGSCAGLVVNFLSARYLVFRAR"
     MKLGREFLSF AVVGAAGFVV DVAVLYLTAP LLGWYGARVL SFLAAATATW ALNRRYTFSA        60
     RSANASVLRE YLGYLVTMLG GAVVNYGAYV LVLHWVTGAW APAAGVALGS CAGLVVNFLS       120
     ARYLVFRAR                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page