(data stored in SCRATCH zone)

EMBL: CP002417.PE205

CP002417.PE205       Location/Qualifiers
FT   CDS             complement(218329..219102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0206"
FT                   /product="Ferredoxin--NADP(+) reductase"
FT                   /EC_number="1.18.1.2"
FT                   /note="KEGG: vap:Vapar_0177 oxidoreductase
FT                   FAD/NAD(P)-binding domain protein; PFAM: oxidoreductase
FT                   FAD/NAD(P)-binding domain protein; Oxidoreductase
FT                   FAD-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34428"
FT                   /db_xref="GOA:E6V0B4"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0B4"
FT                   /inference="protein motif:PRIAM:1.18.1.2"
FT                   /protein_id="ADU34428.1"
FT                   /translation="MSAFSEERVLSVHHWTDRLFTFTTTRDPALRFSNGHFTMIGLKVN
FT                   NKPLLRAYSIVSPNYEEHLEFLSIKVEEGPLTSKLQHIQVGDTIIVGRKPTGTLLIDYT
FT                   LPAKRLYLFGTGTGLAPFMSIIRDPETYEKFEQVILVHGVRQVDELAYHDLVTDHLPKH
FT                   EILGEMIEKQLLYYPTVTREEFRNQGRITDLIESNKLTDDLDLPPLNVEEDRVMLCGSP
FT                   GLLVDLKHILEKRGFKEGNTSTPGDFVVERAFAEK"
     MSAFSEERVL SVHHWTDRLF TFTTTRDPAL RFSNGHFTMI GLKVNNKPLL RAYSIVSPNY        60
     EEHLEFLSIK VEEGPLTSKL QHIQVGDTII VGRKPTGTLL IDYTLPAKRL YLFGTGTGLA       120
     PFMSIIRDPE TYEKFEQVIL VHGVRQVDEL AYHDLVTDHL PKHEILGEMI EKQLLYYPTV       180
     TREEFRNQGR ITDLIESNKL TDDLDLPPLN VEEDRVMLCG SPGLLVDLKH ILEKRGFKEG       240
     NTSTPGDFVV ERAFAEK                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page