(data stored in ACNUC1104 zone)

EMBL: CP002417.PE208

CP002417.PE208       Location/Qualifiers
FT   CDS             221977..222618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0209"
FT                   /product="protein of unknown function DUF1185"
FT                   /note="PFAM: protein of unknown function DUF1185; KEGG:
FT                   vap:Vapar_0180 protein of unknown function DUF1185"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34431"
FT                   /db_xref="InterPro:IPR009569"
FT                   /db_xref="InterPro:IPR035936"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0B7"
FT                   /inference="protein motif:PFAM:PF06684"
FT                   /protein_id="ADU34431.1"
FT                   /translation="MIDIRRVFTHVEHIHHEFGPRADTPLVRGAIGAVLTNPFAGRYEP
FT                   DILPMMALLDPVGVDMAHKLHAAMDVPLEQIATYGKGAIVGADGELEHGALWHVPGGYA
FT                   MRELLGWKGSRVAYTQGVAEEKSGQPANALSIVPSTKKVGPPGAALDVPLTNINASYVR
FT                   GQFDAIEVRVPGAPAADEIVFILAMSTGYRVHARVGGLLAKDISKWDGLR"
     MIDIRRVFTH VEHIHHEFGP RADTPLVRGA IGAVLTNPFA GRYEPDILPM MALLDPVGVD        60
     MAHKLHAAMD VPLEQIATYG KGAIVGADGE LEHGALWHVP GGYAMRELLG WKGSRVAYTQ       120
     GVAEEKSGQP ANALSIVPST KKVGPPGAAL DVPLTNINAS YVRGQFDAIE VRVPGAPAAD       180
     EIVFILAMST GYRVHARVGG LLAKDISKWD GLR                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page